CATH Domain: 2hmaA02 XML data for domain: 2hmaA02

Molscript image for 2hmaA02
2hmaA02
PDB coordinates for domain 2hmaA02

PDB 2hma, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.280 Adenine nucleotide alpha hydrolases-like domains Gene3D
2.30.30.280.1
2.30.30.280.1.1
2.30.30.280.1.1.1
2.30.30.280.1.1.1.1
2.30.30.280.1.1.1.1.1

Segment boundaries for domain 2hmaA02

Chopping figure for domain 2hmaA02
DomainStart PDB ResidueStop PDB Residue
2hmaA01 2 213
2hmaA02 214 282
2hmaA03 283 373

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.30.30.280.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1sf9A02 73.89 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 3 67 3.36 5.00
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hmaA02
YLPAQPGRTVDGRDGEHAGLYYTIGQRGGLGIGGDNAPWFVVGKDLSKNILYVGQGFYHDS    

Domain COMBS Sequence

>pdb|2hmaA02
YLPAQPGRXXTVDGRDXGEHAGLXYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDS    

Domain History Events (222)

Domain assigned by cuff on 14 Apr 2008 10:51

same fold but no functional evidence to suggest homology

Domain assignment manual match t by tronnberg on 15 Nov 2007 09:45

SSAP:76.5 OV: 67 SEQ: 8. I am not sure but I think that the query should be assigned to the same topology as the chosen match.

Homcheck review by tronnberg on 15 Nov 2007 09:45

SSAP:76.5 OV: 67 SEQ: 8. I am not sure but I think that the query should be assigned to the same topology as the chosen match.

Flow stage update by tronnberg on 15 Nov 2007 09:45

SSAP:76.5 OV: 67 SEQ: 8. I am not sure but I think that the query should be assigned to the same topology as the chosen match.

Homcheck comment by tronnberg on 30 Aug 2007 10:47

Not sure, I will come back to this on later.

Homcheck allotment by tronnberg on 29 Aug 2007 09:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 29 Aug 2007 09:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Aug 2007 23:21

Domain "2hmaA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Aug 2007 23:19

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hmaA02

Flow stage update by auto on 28 Aug 2007 23:16

Retrieved PRC_PFAMCATH results for job ID SID3453721629936336 and results inserted.

Domain scan prc pfamcath by auto on 28 Aug 2007 23:15

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 14 results for 2hmaA02

Update comment by auto on 28 Aug 2007 19:16

PRC_PFAMCATH job SID3453721629936336 is not yet finished.

Flow stage update by auto on 28 Aug 2007 19:15

The entry "2hmaA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Aug 2007 19:15

The entry "2hmaA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Aug 2007 18:38

Retrieved SSAP results for job ID SID1706101068703935 and results inserted.

Domain scan ssap cath by auto on 28 Aug 2007 18:36

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1012 results for 2hmaA02

Update comment by auto on 28 Aug 2007 14:59

SSAP job SID1706101068703935 is not yet finished.

Ssap cath submit by auto on 28 Aug 2007 14:50

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 14:50

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Aug 2007 10:16

Giving up on SSAP job SID5366905786043328 because submission time of Sun Aug 26 09:09:39 2007 is more than 172800 seconds older than current time (Tue Aug 28 10:16:15 2007).

Update comment by auto on 26 Aug 2007 09:18

SSAP job SID5366905786043328 is not yet finished.

Ssap cath submit by auto on 26 Aug 2007 09:09

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 09:09

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 26 Aug 2007 02:54

Giving up on SSAP job SID6499972386188656 because submission time of Thu Aug 23 22:31:50 2007 is more than 172800 seconds older than current time (Sun Aug 26 02:54:03 2007).

Update comment by auto on 23 Aug 2007 22:43

SSAP job SID6499972386188656 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:31

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:31

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:34

Giving up on SSAP job SID8527545693898944 because submission time of Tue Aug 21 10:52:29 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:34:12 2007).

Update comment by auto on 21 Aug 2007 11:34

SSAP job SID8527545693898944 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:52

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:52

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:13

Giving up on SSAP job SID6913429578268676 because submission time of Sun Aug 19 07:30:31 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:13:36 2007).

Update comment by auto on 19 Aug 2007 08:24

SSAP job SID6913429578268676 is not yet finished.

Flow stage update by auto on 19 Aug 2007 07:30

The entry "2hmaA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 19 Aug 2007 07:30

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:31

Giving up on SSAP job SID3278083579086064 because submission time of Thu Aug 16 23:23:11 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:31:51 2007).

Update comment by auto on 17 Aug 2007 00:32

SSAP job SID3278083579086064 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:23

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:23

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:30

Giving up on SSAP job SID0820215239956208 because submission time of Tue Aug 14 08:57:20 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:30:55 2007).

Update comment by auto on 14 Aug 2007 10:30

SSAP job SID0820215239956208 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:57

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:57

The entry "2hmaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:45

Retrieved PRC results for job ID SID5759866080044552 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hmaA02

Prc cath submit by auto on 13 Aug 2007 10:23

The entry "2hmaA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 10:23

The entry "2hmaA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 07:12

Retrieved HMM(SAM) results for job ID SID7765346651388748 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 07:11

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hmaA02

Update comment by auto on 12 Aug 2007 13:02

HMM(SAM) job SID7765346651388748 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:45

The entry "2hmaA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:45

The entry "2hmaA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 02:48

Retrieved "2hmaA02" CATHEDRAL results for job ID SID2999103931224688 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 02:47

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 86 results for 2hmaA02

Update comment by auto on 11 Aug 2007 05:48

"2hmaA02" CATHEDRAL job SID2999103931224688 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:12

The entry "2hmaA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:12

The entry "2hmaA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:09

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hmaA02.scanlist" for "2hmaA02"

Write scan list by auto on 11 Aug 2007 02:09

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hmaA02.scanlist" for domain "2hmaA02"

Update comment by auto on 10 Aug 2007 14:32

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:46

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:32

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:57

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:57

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:43

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:50

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:33

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:41

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:03

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:49

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:55

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:44

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:31

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:12

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:42

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:54

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:48

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:36

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:49

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:42

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:20

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:15

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:13

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:03

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:19

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:11

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:49

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:05

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:07

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:07

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:58

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:07

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:54

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:51

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:47

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:58

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 07:00

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:59

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:45

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:28

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:21

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:02

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:02

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 03:01

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:42

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:31

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:03

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:54

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:55

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 03:00

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:41

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:59

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:50

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:08

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:24

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:28

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:30

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:52

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:26

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:03

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:30

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:33

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:33

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:31

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:41

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:14

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:08

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:09

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:10

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:15

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:49

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:08

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:01

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:57

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:59

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:50

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:17

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:40

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 16:02

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:35

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:38

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:48

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 01:02

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:36

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:19

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:19

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:10

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:57

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:26

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:25

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:21

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:24

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:17

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:13

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:33

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:23

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:29

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:32

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:49

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:49

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:47

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:43

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:35

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:59

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:38

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:37

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:42

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:42

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:35

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:59

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:34

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:05

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:55

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:28

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:18

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:14

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:26

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:54

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:59

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:46

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:25

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:44

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:06

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:23

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:18

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:41

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:39

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:59

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:16

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:21

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:22

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:27

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:28

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:08

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:35

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:51

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:08

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:48

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:53

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:31

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:04

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:51

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:43

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:07

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:33

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:37

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:24

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:24

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:15

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:07

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:14

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:05

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:51

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hmaA02" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hmaA02"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hmaA02"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hmaA02"

Insertion by cuff on 06 Jul 2007 13:51

nice chopping