Set cath from cathlist by auto on 05 Mar 2006 18:28
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hlcA01 | 30 | 121 |
| 2hlcA01 | 235 | 246 |
| 2hlcA02 | 16 | 29 |
| 2hlcA02 | 122 | 234 |
There are 9 matching structural neighberhood comparisons for CATH ID 2.40.10.10.57.1.1.1.1 (SIMAX score < 5)
>pdb|2hlcA02 IINGYEAYTGLFPYRLPSGEELNNKFENIWATVSGWGQSNTDTVILQYTYNLVIDNDRCAQEYPPGIIVESTICGDTSDG KSPCFGDSGGPFVLSDKNLLIGVVSFVSGAGCESGKPVGFSRVTSY
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"