CATH Domain: 2hj1A00 XML data for domain: 2hj1A00

Molscript image for 2hj1A00
2hj1A00
PDB coordinates for domain 2hj1A00

PDB 2hj1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.20 Ubiquitin-like (UB roll)
3.10.20.280 3d domain-swapped dimer of a hypothetical protein Gene3D
3.10.20.280.1
3.10.20.280.1.1
3.10.20.280.1.1.1
3.10.20.280.1.1.1.1
3.10.20.280.1.1.1.1.1

[top]
Segment boundaries for domain 2hj1A00

Chopping figure for domain 2hj1A00
DomainStart PDB ResidueStop PDB Residue
2hj1A00 11 87

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2hj1A00
NQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hj1A00
MAHHHHHHSLNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRI
EIYRPLLADPKEIRREG
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 20 Feb 2008 20:16

Assigning to "3.10.20.280" based on similarity with "2hj1B00"

Flow stage update by auto on 20 Feb 2008 20:05

No in_process hits for Domain "2hj1A00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2hj1A00" hits Domain "2hj1B00" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hj1A00" hits Domain "2hj1B00" (100% over 100%) which is currently in process

Update comment by auto on 26 Aug 2007 22:06

Domain "2hj1A00" hits Domain "2hj1B00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Aug 2007 22:05

Domain "2hj1A00" hits Domain "2hj1B00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Aug 2007 22:05

NW result present for Domain "2hj1A00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2hj1A00"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2hj1A00"

Insertion by auto on 18 Aug 2007 14:04

Final ChopClose added based on similarity with "2hj1B"