Domain assigned by auto on 06 Sep 2007 14:18
Assigning to "3.40.810.20" based on similarity with "1xr4A02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hj0A01 | 3 | 242 |
| 2hj0A01 | 488 | 513 |
| 2hj0A02 | 243 | 487 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2hj0A02 GATRYTKNPKELLIAEYAAKVITSSPYYKEGFSFQTGTGGASLAVTRFREQIKDDIKANFALGGITNAVELLEEGLVDKI LDVQDFDHPSAVSLDRNAEKHYEIDANYASPLSKGSVINQLDICVLSALEVDTNFNVNVTGSDGVIRGASGGHCDTAFAA KSLVISPLVRGRIPTFVDKVNTVITPGTSVDVVVTEVGIAINPNRPDLIEYFKDLKVPQLTIEELKEKAYAIVGNPQPI
Assigning to "3.40.810.20" based on similarity with "1xr4A02"
No in_process hits for Domain "2hj0A02" ready to be processed
NW result present for Domain "2hj0A02"
All required files are present for Domain "2hj0A02"
Beginning processing for Domain "2hj0A02"
nice chopping