Domain assigned by cuff on 12 Feb 2008 12:55
def homology
CATH Domain: 2hi6A00
2hi6A00
PDB 2hi6, Chain A, Domain 0
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 3.50.30.10.4.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1a9xB01 | 78.81 | 3.50.30.20 | 150 | 12 | 78 | 3.92 | 4.98 | |
 |
1ko7A01 | 76.02 | 3.40.1390.20 | 129 | 10 | 73 | 3.58 | 4.87 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|2hi6A00 VKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPKA IINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIE
Domain History Events (76)
Domain assignment manual match h by cuff on 12 Feb 2008 12:55
same superfamily
Domain assignment manual match t by tronnberg on 07 Sep 2007 11:40
SSAP: 80.94 OV: 75 SEQ: 15. Reasonable similar linkage and structure.
Homcheck review by tronnberg on 07 Sep 2007 11:40
SSAP: 80.94 OV: 75 SEQ: 15. Reasonable similar linkage and structure.
Flow stage update by tronnberg on 07 Sep 2007 11:40
SSAP: 80.94 OV: 75 SEQ: 15. Reasonable similar linkage and structure.
Homcheck allotment by tronnberg on 07 Sep 2007 11:38
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 07 Sep 2007 11:38
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 07 Sep 2007 02:59
Domain "2hi6A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 07 Sep 2007 02:58
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hi6A00
Flow stage update by auto on 07 Sep 2007 00:54
Retrieved PRC_PFAMCATH results for job ID SID8259004786643168 and results inserted.
Domain scan prc pfamcath by auto on 07 Sep 2007 00:53
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hi6A00
Update comment by auto on 06 Sep 2007 16:14
PRC_PFAMCATH job SID8259004786643168 is not yet finished.
Prc pfamcath submit by auto on 06 Sep 2007 16:08
The entry "2hi6A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Sep 2007 16:08
The entry "2hi6A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Sep 2007 14:49
Retrieved SSAP results for job ID SID0331896196747296 and results inserted.
Domain scan ssap cath by auto on 06 Sep 2007 14:47
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1298 results for 2hi6A00
Update comment by auto on 05 Sep 2007 19:15
SSAP job SID0331896196747296 is not yet finished.
Flow stage update by auto on 05 Sep 2007 15:42
The entry "2hi6A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 15:42
The entry "2hi6A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 05:44
Retrieved PRC results for job ID SID4478312465024000 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 05:43
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hi6A00
Prc cath submit by auto on 05 Sep 2007 03:10
The entry "2hi6A00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:10
The entry "2hi6A00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 14:37
Retrieved HMM(SAM) results for job ID SID1720828575773312 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 14:36
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hi6A00
Update comment by auto on 04 Sep 2007 11:22
HMM(SAM) job SID1720828575773312 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:32
The entry "2hi6A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:32
The entry "2hi6A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 21:23
Retrieved "2hi6A00" CATHEDRAL results for job ID SID7729101828666352 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 21:22
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 520 results for 2hi6A00
Cathedral cath submit by auto on 03 Sep 2007 13:41
The entry "2hi6A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:41
The entry "2hi6A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:34
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hi6A00.scanlist" for "2hi6A00"
Write scan list by auto on 03 Sep 2007 11:33
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hi6A00.scanlist" for domain "2hi6A00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:13
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:25
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:10
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:12
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:14
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:12
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:29
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:04
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:15
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:35
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:14
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:21
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:27
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:31
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:48
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:10
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:19
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:19
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:12
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:12
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 10:25
Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 06:30
Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 02:23
Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 22:19
Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 26 Aug 2007 22:12
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Aug 2007 22:05
No in_process hits for Domain "2hi6A00" ready to be processed
Flow stage update by auto on 26 Aug 2007 22:05
NW result present for Domain "2hi6A00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2hi6A00"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2hi6A00"
Insertion by cuff on 18 Aug 2007 12:35
nice chopping
