CATH Domain: 2hi0A02 XML data for domain: 2hi0A02

Molscript image for 2hi0A02
2hi0A02
PDB coordinates for domain 2hi0A02

PDB 2hi0, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.10
1.10.150.240.10.1
1.10.150.240.10.1.1
1.10.150.240.10.1.1.1
1.10.150.240.10.1.1.1.1

[top]
Segment boundaries for domain 2hi0A02

Chopping figure for domain 2hi0A02
DomainStart PDB ResidueStop PDB Residue
2hi0A01 0 17
2hi0A01 107 239
2hi0A02 18 106

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.150.240.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ah5A02 83.16 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 17 70 1.89 2.66
2hdoA02 77.51 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 1.10.150.240 59 13 67 2.67 3.96
2nyvA02 77.10 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 10 66 3.02 4.56
1sxjE02 76.18 Leading strand elongationNucleotide excision repairDNA replicationReplication factor C subunit 3/5Sister chromatid cohesion 1.10.8.60 64 7 61 3.05 4.95
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hi0A02
SADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGVVVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFK
PYYADHCQI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hi0A02
SADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGVVVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFK
PYYADHCQI
BLAST against CATH

[top]
Domain History Events (56)

Classification merge by cuff on 12 Nov 2010 19:13

COMMENT: merge fold and superfamily FINAL: merge: 1.10.164.10 --> 1.10.150.240

Domain assigned by cuff on 12 Feb 2008 12:57

agree. same superfamily

Domain assignment manual match h by rupa on 07 Sep 2007 11:39

Very high ssap score, same fold and same function.

Homcheck review by rupa on 07 Sep 2007 11:39

Very high ssap score, same fold and same function.

Flow stage update by rupa on 07 Sep 2007 11:39

Very high ssap score, same fold and same function.

Homcheck allotment by rupa on 07 Sep 2007 11:38

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 07 Sep 2007 11:38

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:58

Domain "2hi0A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:57

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hi0A02

Flow stage update by auto on 07 Sep 2007 00:51

Retrieved PRC_PFAMCATH results for job ID SID7734704912728244 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:50

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hi0A02

Update comment by auto on 06 Sep 2007 08:28

PRC_PFAMCATH job SID7734704912728244 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 08:23

The entry "2hi0A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 08:23

The entry "2hi0A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 07:05

Retrieved SSAP results for job ID SID0600832387850368 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 07:00

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2558 results for 2hi0A02

Update comment by auto on 05 Sep 2007 19:15

SSAP job SID0600832387850368 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:41

The entry "2hi0A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:41

The entry "2hi0A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:42

Retrieved PRC results for job ID SID4793066269130976 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hi0A02

Flow stage update by auto on 05 Sep 2007 03:10

The entry "2hi0A02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:10

The entry "2hi0A02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 14:34

Retrieved HMM(SAM) results for job ID SID9178363049091890 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 14:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hi0A02

Update comment by auto on 04 Sep 2007 11:22

HMM(SAM) job SID9178363049091890 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:31

The entry "2hi0A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:31

The entry "2hi0A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:21

Retrieved "2hi0A02" CATHEDRAL results for job ID SID6153646710022296 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:20

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 175 results for 2hi0A02

Flow stage update by auto on 03 Sep 2007 13:40

The entry "2hi0A02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 13:40

The entry "2hi0A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:33

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A02.scanlist" for "2hi0A02"

Write scan list by auto on 03 Sep 2007 11:33

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A02.scanlist" for domain "2hi0A02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Aug 2007 15:37

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Aug 2007 15:27

No in_process hits for Domain "2hi0A02" ready to be processed

Flow stage update by auto on 30 Aug 2007 15:26

NW result present for Domain "2hi0A02"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2hi0A02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2hi0A02"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping