Domain assigned by cuff on 11 Feb 2008 14:02
def homology
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.50
| Rossmann fold | |
3.40.50.1000
| Gene3D | |
3.40.50.1000.13
| ||
3.40.50.1000.13.1
| ||
3.40.50.1000.13.1.1
| ||
3.40.50.1000.13.1.1.1
| ||
3.40.50.1000.13.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hi0A01 | 0 | 17 |
| 2hi0A01 | 107 | 239 |
| 2hi0A02 | 18 | 106 |
There are 37 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.13.1.1.1.1 (SIMAX score < 5)
>pdb|2hi0A01 GKYKAAIFDDGTILDTKTGPFPGILDLKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPDTSE CVKVLGVPRDKCVYIGDSEIDIQTARNSEDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE
def homology
SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.
SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.
SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2hi0A01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hi0A01
Retrieved PRC_PFAMCATH results for job ID SID8185407861335584 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 299 results for 2hi0A01
PRC_PFAMCATH job SID8185407861335584 is not yet finished.
The entry "2hi0A01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2hi0A01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID9384574243999112 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1852 results for 2hi0A01
SSAP job SID9384574243999112 is not yet finished.
The entry "2hi0A01" has been submitted to the SSAP webservice.
The entry "2hi0A01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID4850196704634672 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 49 results for 2hi0A01
The entry "2hi0A01" has been submitted to the PRC webservice.
The entry "2hi0A01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID6992845861667616 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 40 results for 2hi0A01
HMM(SAM) job SID6992845861667616 is not yet finished.
The entry "2hi0A01" has been submitted to the HMM (SAM) webservice.
The entry "2hi0A01" has been submitted to the HMM (SAM) webservice.
Retrieved "2hi0A01" CATHEDRAL results for job ID SID4158749484565824 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2hi0A01
The entry "2hi0A01" has been submitted to the CATHEDRAL webservice.
The entry "2hi0A01" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A01.scanlist" for "2hi0A01"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A01.scanlist" for domain "2hi0A01"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2hi0A01" ready to be processed
NW result present for Domain "2hi0A01"
All required files are present for Domain "2hi0A01"
Beginning processing for Domain "2hi0A01"
nice chopping