CATH Domain: 2hi0A01 XML data for domain: 2hi0A01

Molscript image for 2hi0A01
2hi0A01
PDB coordinates for domain 2hi0A01

PDB 2hi0, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.13
3.40.50.1000.13.1
3.40.50.1000.13.1.1
3.40.50.1000.13.1.1.1
3.40.50.1000.13.1.1.1.1

Segment boundaries for domain 2hi0A01

Chopping figure for domain 2hi0A01
DomainStart PDB ResidueStop PDB Residue
2hi0A01 0 17
2hi0A01 107 239
2hi0A02 18 106

Structural Neighbourhood (37 entries)

There are 37 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.13.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 37 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hszA01 90.07 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 23 95 2.04 2.13
3d6jA01 89.83 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 23 91 1.72 1.89
2ah5A01 89.59 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 23 95 1.91 2.01
2nyvA01 89.30 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 26 92 2.06 2.22
3e58B01 87.50 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 23 89 1.88 2.11
2fdrA01 87.45 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 22 93 2.42 2.59
2hdoA01 87.28 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 3.40.50.1000 134 21 90 2.24 2.48
3ed5A01 86.84 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 22 92 2.36 2.55
1te2A01 86.73 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 23 94 2.23 2.36
2fi1A01 86.65 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 25 80 1.93 2.39
2hcfA01 85.60 Chlorobaculum tepidumHydrolase, haloacid dehalogenase-like family 3.40.50.1000 156 20 89 2.09 2.33
1swvA01 85.40 Bacillus cereusPhosphonoacetaldehyde hydrolase 3.40.50.1000 178 23 81 2.40 2.95
2pkeA01 84.78 Xanthomonas campestris pv. campestrisPutative hydrolase of the HAD superfamilyHydrolase, haloacid delahogenase-like family 3.40.50.1000 152 11 86 2.80 3.25
1zjjB01 84.27 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 19 92 2.28 2.47
2oycA01 84.06 Vitamin B6 metabolismPyridoxal phosphate phosphataseHomo sapiensPyridoxal phosphatase [EC:3.1.3.74]Metabolic pathways 3.40.50.1000 167 19 80 2.10 2.62
2b0cA01 83.84 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 18 84 2.59 3.05
3i28A01 83.53 PeroxisomeSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase activityEpoxide hydrolase 2 3.40.50.1000 135 21 83 3.24 3.88
2qltA01 83.29 Response to osmotic stressNucleusProtein bindingMetabolic pathwaysCytoplasm 3.40.50.1000 171 21 83 3.10 3.71
1u7pD00 83.20 Mus musculusMagnesium-dependent phosphatase 1 3.40.50.1000 161 16 77 2.28 2.94
2hx1A01 83.12 Cytophaga hutchinsonii ATCC 33406Possible sugar phosphatase, HAD superfamily 3.40.50.1000 155 19 83 2.81 3.38
2pr7A00 82.91 Corynebacterium glutamicumHaloacid dehalogenase/epoxide hydrolase family 3.40.50.1000 131 18 84 3.10 3.65
2ho4B01 82.77 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 24 87 2.54 2.91
2p11A01 81.79 Burkholderia xenovorans LB400Putative uncharacterized protein 3.40.50.1000 140 15 86 2.88 3.31
1wpgA04 81.64 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 12 78 3.26 4.13
1k1eD00 81.42 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]Haemophilus influenzaeLipopolysaccharide biosynthesisMetabolic pathways 3.40.50.1000 170 17 78 2.60 3.32
3bwvA01 80.88 Putative 5'(3')-deoxyribonucleotidaseStaphylococcus epidermidis ATCC 12228 3.40.50.1000 121 9 78 2.79 3.54
1cqzA01 80.81 PeroxisomeMus musculusSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase 2 3.40.50.1000 162 19 77 3.31 4.29
3fvvA01 80.67 Bordetella pertussisPutative uncharacterized protein 3.40.50.1000 148 13 85 3.05 3.58
1rkuA01 80.66 Glycine, serine and threonine metabolismMetabolic pathwaysPhosphoserine / homoserine phosphotransferase [EC:3.1.3.3 2.7.1.39]Pseudomonas aeruginosaHomoserine kinase 3.40.50.1000 111 16 69 2.66 3.85
2i6xA01 80.23 Hydrolase, haloacid dehalogenase-like familyPutative hydrolase of the HAD superfamilyPorphyromonas gingivalis 3.40.50.1000 127 17 81 2.76 3.39
1rlmA01 80.14 Sugar phosphatase supHSugar-phosphatase [EC:3.1.3.23]Escherichia coli K-12 3.40.50.1000 162 19 85 3.59 4.18
1nf2A01 79.95 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 13 86 3.36 3.86
1u02A01 78.89 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.40.50.1000 149 13 82 3.38 4.09
3cnhA01 78.84 Hydrolase family proteinPutative hydrolase of the HAD superfamilyDeinococcus radiodurans 3.40.50.1000 114 21 77 2.92 3.77
1ltqA02 78.77 Polynucleotide kinaseEnterobacteria phage T4 3.40.50.1000 136 17 75 3.23 4.29
2o2xA01 77.71 Mll2559 proteinMesorhizobium loti 3.40.50.1000 196 20 68 3.25 4.75
3b8cA03 76.94 Oxidative phosphorylationArabidopsis thalianaPlasma membraneATPase 2, plasma membrane-typeProtein binding 3.40.50.1000 163 10 79 3.53 4.46
Displaying entries 1 to 37 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hi0A01
GKYKAAIFDDGTILDTKTGPFPGILDLKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPDTSE
CVKVLGVPRDKCVYIGDSEIDIQTARNSEDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE    

Domain COMBS Sequence

>pdb|2hi0A01
GXKYKAAIFDXDGTILDTKTGPFPGILDLXKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPD
XTSECVKVLGVPRDKCVYIGDSEIDIQTARNSEXDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE    

Domain History Events (55)

Domain assigned by cuff on 11 Feb 2008 14:02

def homology

Domain assignment manual match h by tronnberg on 07 Sep 2007 11:36

SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.

Homcheck review by tronnberg on 07 Sep 2007 11:36

SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.

Flow stage update by tronnberg on 07 Sep 2007 11:36

SSAP: 81.57 OV: 85 SEQ: 17. Similar linkage, the only difference between the structures is a small beta sheet. Share same functon as phosphoglycolate phosphatase.

Homcheck allotment by tronnberg on 07 Sep 2007 11:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 11:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:56

Domain "2hi0A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:55

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hi0A01

Flow stage update by auto on 07 Sep 2007 00:53

Retrieved PRC_PFAMCATH results for job ID SID8185407861335584 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 299 results for 2hi0A01

Update comment by auto on 06 Sep 2007 16:14

PRC_PFAMCATH job SID8185407861335584 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 16:08

The entry "2hi0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 16:08

The entry "2hi0A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 14:47

Retrieved SSAP results for job ID SID9384574243999112 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 14:43

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1852 results for 2hi0A01

Update comment by auto on 05 Sep 2007 19:15

SSAP job SID9384574243999112 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:41

The entry "2hi0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:41

The entry "2hi0A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:41

Retrieved PRC results for job ID SID4850196704634672 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:41

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 49 results for 2hi0A01

Flow stage update by auto on 05 Sep 2007 03:10

The entry "2hi0A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:10

The entry "2hi0A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 14:33

Retrieved HMM(SAM) results for job ID SID6992845861667616 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 14:32

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 40 results for 2hi0A01

Update comment by auto on 04 Sep 2007 11:22

HMM(SAM) job SID6992845861667616 is not yet finished.

Flow stage update by auto on 04 Sep 2007 09:31

The entry "2hi0A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:31

The entry "2hi0A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:19

Retrieved "2hi0A01" CATHEDRAL results for job ID SID4158749484565824 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:18

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2hi0A01

Cathedral cath submit by auto on 03 Sep 2007 13:40

The entry "2hi0A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:40

The entry "2hi0A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:33

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A01.scanlist" for "2hi0A01"

Write scan list by auto on 03 Sep 2007 11:33

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hi0A01.scanlist" for domain "2hi0A01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:14

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Flow stage update by auto on 30 Aug 2007 15:37

No satisfactory AssignClose result found.

Flow stage update by auto on 30 Aug 2007 15:27

No in_process hits for Domain "2hi0A01" ready to be processed

Flow stage update by auto on 30 Aug 2007 15:26

NW result present for Domain "2hi0A01"

Flow stage update by auto on 24 Aug 2007 10:05

All required files are present for Domain "2hi0A01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2hi0A01"

Insertion by cuff on 23 Aug 2007 12:19

nice chopping