Domain assigned by auto on 27 Jul 2007 22:27
Assigning to "3.30.460.10" based on similarity with "1fa0A02"
CATH Domain: 2hhpA02
2hhpA02
PDB 2hhp, Chain A, Domain 2
Segment boundaries for domain 2hhpA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hhpA01 | 4 | 39 |
| 2hhpA01 | 196 | 352 |
| 2hhpA02 | 40 | 195 |
| 2hhpA03 | 353 | 522 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.460.10.10.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1jmsA03 | 77.81 | 3.30.460.10 | 136 | 10 | 66 | 2.74 | 4.14 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2hhpA02 ETEQETANRVQVLKILQELAQRFVYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTV FDSLLRERKELDEIAPVPDAFVPIIKIKFSGISIDLICARLDQPQVPLSLTLSDKNLLRNLDEKDLRALNGTRVTD
Domain History Events (6)
Flow stage update by auto on 27 Jul 2007 22:24
No in_process hits for Domain "2hhpA02" ready to be processed
Flow stage update by auto on 27 Jul 2007 22:24
NW result present for Domain "2hhpA02"
Flow stage update by auto on 14 Jul 2007 06:02
All required files are present for Domain "2hhpA02"
Flow stage update by auto on 13 Jul 2007 18:42
Beginning processing for Domain "2hhpA02"
Insertion by auto on 13 Jul 2007 08:38
Final ChopClose added based on similarity with "1fa0B"
