CATH Domain: 2hhjB00 XML data for domain: 2hhjB00

Molscript image for 2hhjB00
2hhjB00
PDB coordinates for domain 2hhjB00

PDB 2hhj, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1240 Phosphoglycerate mutase-like Gene3D
3.40.50.1240.2
3.40.50.1240.2.1
3.40.50.1240.2.1.1
3.40.50.1240.2.1.1.1
3.40.50.1240.2.1.1.1.1

[top]
Segment boundaries for domain 2hhjB00

Chopping figure for domain 2hhjB00
DomainStart PDB ResidueStop PDB Residue
2hhjB00 2 255

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.50.1240.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1h2eA00 84.11 Phosphoglycerate mutaseGeobacillus stearothermophilus 3.40.50.1240 207 22 79 2.86 3.58
1bifA02 82.67 Identical protein bindingRattus norvegicus6-phosphofructo-2-kinase activity6-phosphofructo-2-kinase [EC:2.7.1.105]Fructose and mannose metabolism 3.40.50.1240 221 19 79 3.66 4.61
1v37A00 80.75 Thermus thermophilus HB8Phosphoglycerate mutase [EC:5.4.2.1]Glycolysis / GluconeogenesisAlpha-ribazole-5'-phosphate phosphataseMetabolic pathways 3.40.50.1240 171 27 66 2.63 3.94
1ujcA00 78.03 CytoplasmPhosphohistidine phosphatase activityPhosphohistidine phosphatase [EC:3.1.3.-]Phosphohistidine phosphatase sixAProtein modification process 3.40.50.1240 156 17 60 2.89 4.78
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hhjB00
SKYKLIMLRGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVE
SSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVL
ERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQ
AAIKKVEDQGKVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hhjB00
MSKYKLIMLRXGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVP
VESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKD
VLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEA
IQAAIKKVEDQGKVKQAKKLEHHHHHH
BLAST against CATH

[top]
Domain History Events (29)

Domain assigned by auto on 15 Aug 2007 09:22

Assigning to "3.40.50.1240" based on similarity with "2a9jA00"

Flow stage update by auto on 15 Aug 2007 09:21

No in_process hits for Domain "2hhjB00" ready to be processed

Update comment by auto on 15 Aug 2007 09:17

Domain "2hhjB00" hits Domain "2hhjA00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:13

Domain "2hhjB00" hits Domain "2h4zA00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:09

Domain "2hhjB00" hits Domain "2h52B00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:06

Domain "2hhjB00" hits Domain "2h52A00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:00

Domain "2hhjB00" hits Domain "2h4xB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:48

Domain "2hhjB00" hits Domain "2f90A00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:30

Domain "2hhjB00" hits Domain "2a9jB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:07

Domain "2hhjB00" hits Domain "1yjxG00" (54.0650406504065% over 92.1348314606742%) which is currently in process

Update comment by auto on 15 Aug 2007 07:43

Domain "2hhjB00" hits Domain "1yjxB00" (54.320987654321% over 91.0112359550562%) which is currently in process

Update comment by auto on 15 Aug 2007 07:14

Domain "2hhjB00" hits Domain "1yjxC00" (53.8775510204082% over 91.7602996254682%) which is currently in process

Update comment by auto on 15 Aug 2007 06:54

Domain "2hhjB00" hits Domain "1yjxA00" (54.0650406504065% over 92.1348314606742%) which is currently in process

Update comment by auto on 15 Aug 2007 06:32

Domain "2hhjB00" hits Domain "1yjxH00" (54.0983606557377% over 91.3857677902622%) which is currently in process

Update comment by auto on 15 Aug 2007 06:07

Domain "2hhjB00" hits Domain "1yjxI00" (53.8775510204082% over 91.7602996254682%) which is currently in process

Update comment by auto on 15 Aug 2007 05:38

Domain "2hhjB00" hits Domain "1yjxD00" (54.0650406504065% over 92.1348314606742%) which is currently in process

Update comment by auto on 15 Aug 2007 05:06

Domain "2hhjB00" hits Domain "1yjxL00" (54.0650406504065% over 92.1348314606742%) which is currently in process

Update comment by auto on 15 Aug 2007 04:35

Domain "2hhjB00" hits Domain "1yjxF00" (54.0983606557377% over 91.3857677902622%) which is currently in process

Update comment by auto on 15 Aug 2007 04:00

Domain "2hhjB00" hits Domain "1yjxE00" (54.0983606557377% over 91.3857677902622%) which is currently in process

Update comment by auto on 15 Aug 2007 03:21

Domain "2hhjB00" hits Domain "1yjxK00" (54.356846473029% over 90.2621722846442%) which is currently in process

Update comment by auto on 15 Aug 2007 02:39

Domain "2hhjB00" hits Domain "1yjxJ00" (54.0650406504065% over 92.1348314606742%) which is currently in process

Update comment by auto on 15 Aug 2007 01:37

Domain "2hhjB00" hits Domain "1yfkA00" (53.8775510204082% over 91.7602996254682%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2hhjB00" hits Domain "1yfkB00" (54.5454545454545% over 90.6367041198502%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2hhjB00" hits Domain "1t8pA00" (100% over 93.6329588014981%) which is currently in process

Flow stage update by auto on 10 Aug 2007 02:33

Domain "2hhjB00" hits Domain "2h4zB00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Aug 2007 02:33

NW result present for Domain "2hhjB00"

Flow stage update by auto on 20 Jul 2007 02:44

All required files are present for Domain "2hhjB00"

Flow stage update by auto on 18 Jul 2007 14:45

Beginning processing for Domain "2hhjB00"

Insertion by auto on 18 Jul 2007 14:09

Final ChopClose added based on similarity with "2a9jA"