Domain assigned by auto on 15 Apr 2008 14:14
Assigning to "1.10.3210.10" based on similarity with "2hekB01"
CATH Domain: 2hekA01
2hekA01
PDB 2hek, Chain A, Domain 1
Segment boundaries for domain 2hekA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hekA01 | 1 | 281 |
| 2hekA02 | 282 | 369 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2hekA01 MIKEFSDPLYGFVRVGEAGLRLIDSFPFQRLRYVKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKEKELVKLA GLLHDLGHPPFSHTTEVLLPRERSHEDFTERVIKETEIYEILKQDYSHEDIERLVRITLGKPEDEEEKLLSEIITGEFGS DRMDYLRRDAYFCGVSYGFFDYDRLISTLRVYENKVVVDESGLRALENFLISRYFMYVQVYFHKVVRILSIHLVEFLKKL ISQEDFTDINNFLRLNDAFVISELFKRKAFREDFERIFQRK
Domain COMBS Sequence
>pdb|2hekA01 MIKEFSDPLYGFVRVGEAGLRLIDSFPFQRLRYVKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKEKELVKLA GLLHDLGHPPFSHTTEVLLPRERSHEDFTERVIKETEIYEILKQDYSHEDIERLVRITLGKPEDEEEKLLSEIITGEFGS DRMDYLRRDAYFCGVSYGFFDYDRLISTLRVYENKVVVDESGLRALENFLISRYFMYVQVYFHKVVRILSIHLVEFLKKL ISQEDFTDINNFLRLNDAFVISELFKRKAFREDFERIFQRK
Domain History Events (8)
Flow stage update by auto on 15 Apr 2008 14:04
No in_process hits for Domain "2hekA01" ready to be processed
Update comment by auto on 06 Sep 2007 14:06
Domain "2hekA01" hits Domain "2hekB01" (100% over 100%) which is currently in process
Flow stage update by auto on 06 Sep 2007 14:06
Domain "2hekA01" hits Domain "2hekB01" (100% over 100%) which is currently in process
Flow stage update by auto on 06 Sep 2007 14:06
NW result present for Domain "2hekA01"
Flow stage update by auto on 04 Sep 2007 14:04
All required files are present for Domain "2hekA01"
Flow stage update by auto on 03 Sep 2007 20:09
Beginning processing for Domain "2hekA01"
Insertion by auto on 03 Sep 2007 18:04
Final ChopClose added based on similarity with "2hekB"
