CATH Domain: 2hdoA02 XML data for domain: 2hdoA02

Molscript image for 2hdoA02
2hdoA02
PDB coordinates for domain 2hdoA02

PDB 2hdo, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.13
1.10.150.240.13.1
1.10.150.240.13.1.1
1.10.150.240.13.1.1.1
1.10.150.240.13.1.1.1.1

Segment boundaries for domain 2hdoA02

Chopping figure for domain 2hdoA02
DomainStart PDB ResidueStop PDB Residue
2hdoA01 2 16
2hdoA01 81 207
2hdoA02 17 80

Domain ATOM Sequence

>pdb|2hdoA02
SQPAYTTVREVLATYGKPFSPAQAQKTFPAAEQATELGIAASEFDHFQAQYEDVASHYDQ    

Domain COMBS Sequence

>pdb|2hdoA02
SQPAYTTVXREVLATYGKPFSPAQAQKTFPXAAEQAXTELGIAASEFDHFQAQYEDVXASHYDQ    

Domain History Events (216)

Classification merge by cuff on 12 Nov 2010 19:13

COMMENT: merge fold and superfamily FINAL: merge: 1.10.164.10 --> 1.10.150.240

Domain assigned by cuff on 07 Feb 2008 13:12

same superfamily

Domain assignment manual match h by cuff on 07 Feb 2008 13:10

same superfamily. SCOP concurs

Domain assignment manual match t by tronnberg on 05 Sep 2007 12:15

SSAP: 83.98 OV: 75 SEQ: 10. Similar linkage and structure. Functionally different. I think that 2fi1A02 (TBA) should be assign to the same topology family.

Homcheck review by tronnberg on 05 Sep 2007 12:15

SSAP: 83.98 OV: 75 SEQ: 10. Similar linkage and structure. Functionally different. I think that 2fi1A02 (TBA) should be assign to the same topology family.

Flow stage update by tronnberg on 05 Sep 2007 12:15

SSAP: 83.98 OV: 75 SEQ: 10. Similar linkage and structure. Functionally different. I think that 2fi1A02 (TBA) should be assign to the same topology family.

Domain assignment manual match t by tronnberg on 28 Aug 2007 14:45

SSAP= 85, OV= 89, Seq sim= 20. Very similar linkage.

Homcheck allotment by tronnberg on 28 Aug 2007 14:41

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 14:41

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 24 Aug 2007 23:36

Domain "2hdoA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 24 Aug 2007 23:35

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hdoA02

Flow stage update by auto on 24 Aug 2007 23:04

Retrieved PRC_PFAMCATH results for job ID SID3801393690056330 and results inserted.

Domain scan prc pfamcath by auto on 24 Aug 2007 23:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2hdoA02

Update comment by auto on 24 Aug 2007 19:44

PRC_PFAMCATH job SID3801393690056330 is not yet finished.

Prc pfamcath submit by auto on 24 Aug 2007 19:41

The entry "2hdoA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Aug 2007 19:41

The entry "2hdoA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Aug 2007 18:48

Retrieved SSAP results for job ID SID1670990123972672 and results inserted.

Domain scan ssap cath by auto on 24 Aug 2007 18:45

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1384 results for 2hdoA02

Update comment by auto on 23 Aug 2007 22:41

SSAP job SID1670990123972672 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:29

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:29

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:32

Giving up on SSAP job SID5452277176532192 because submission time of Tue Aug 21 10:49:26 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:32:01 2007).

Update comment by auto on 21 Aug 2007 11:32

SSAP job SID5452277176532192 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:49

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:49

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:10

Giving up on SSAP job SID2251268580514668 because submission time of Sun Aug 19 07:26:40 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:10:07 2007).

Update comment by auto on 19 Aug 2007 08:21

SSAP job SID2251268580514668 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:26

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:26

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:28

Giving up on SSAP job SID9184565533392752 because submission time of Thu Aug 16 23:19:34 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:28:27 2007).

Update comment by auto on 17 Aug 2007 00:29

SSAP job SID9184565533392752 is not yet finished.

Flow stage update by auto on 16 Aug 2007 23:19

The entry "2hdoA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Aug 2007 23:19

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:26

Giving up on SSAP job SID5751361329937328 because submission time of Tue Aug 14 08:52:20 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:51 2007).

Update comment by auto on 14 Aug 2007 10:27

SSAP job SID5751361329937328 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:52

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:52

The entry "2hdoA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:14

Retrieved PRC results for job ID SID8411295949177268 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:13

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2hdoA02

Prc cath submit by auto on 13 Aug 2007 10:16

The entry "2hdoA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 10:16

The entry "2hdoA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 06:45

Retrieved HMM(SAM) results for job ID SID0474963868565309 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 06:44

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2hdoA02

Update comment by auto on 12 Aug 2007 12:59

HMM(SAM) job SID0474963868565309 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:41

The entry "2hdoA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:41

The entry "2hdoA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 02:04

Retrieved "2hdoA02" CATHEDRAL results for job ID SID6591531112620640 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 02:03

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 70 results for 2hdoA02

Update comment by auto on 11 Aug 2007 05:44

"2hdoA02" CATHEDRAL job SID6591531112620640 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:06

The entry "2hdoA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:06

The entry "2hdoA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:59

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA02.scanlist" for "2hdoA02"

Write scan list by auto on 11 Aug 2007 01:59

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA02.scanlist" for domain "2hdoA02"

Update comment by auto on 10 Aug 2007 14:31

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:45

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:31

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:56

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:56

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:42

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:49

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:32

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:41

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:02

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:48

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:54

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:43

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:30

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:11

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:41

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:53

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:47

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:35

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:48

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:42

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:20

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:14

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:12

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:02

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:18

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:09

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:48

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:04

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:06

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:06

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:57

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:06

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:53

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:50

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:45

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:57

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:59

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:58

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:44

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:27

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:20

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:01

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:00

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:59

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:41

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:30

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:02

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:52

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:54

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:59

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:40

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:58

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:49

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:07

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:22

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:27

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:29

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:51

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:24

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:02

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:29

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:31

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:30

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:29

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:38

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:12

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:06

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:07

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:08

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:13

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:48

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:06

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:00

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:55

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:57

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:49

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:15

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:37

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 16:00

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:32

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:36

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:46

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 01:00

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:33

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:16

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:17

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:08

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:55

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:23

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:23

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:18

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:21

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:14

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:11

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:31

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:20

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:27

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:30

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:46

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:47

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:44

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:41

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:33

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:56

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:35

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:34

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:39

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:40

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:33

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:57

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:32

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:04

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:53

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:27

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:15

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:12

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:24

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:52

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:56

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:43

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:23

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:41

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:04

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:21

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:16

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:38

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:36

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:57

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:13

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:17

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:18

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:24

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:25

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:07

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:32

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:48

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:07

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:47

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:52

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:29

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:02

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:49

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:41

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:06

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:32

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:36

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:23

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:23

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:14

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:06

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:13

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:04

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:49

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hdoA02" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hdoA02"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hdoA02"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hdoA02"

Insertion by cuff on 06 Jul 2007 12:33

nice chopping