Domain assigned by cuff on 07 Feb 2008 13:07
obvious homology
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.50
| Rossmann fold | |
3.40.50.1000
| Gene3D | |
3.40.50.1000.23
| ||
3.40.50.1000.23.1
| ||
3.40.50.1000.23.1.1
| ||
3.40.50.1000.23.1.1.1
| ||
3.40.50.1000.23.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2hdoA01 | 2 | 16 |
| 2hdoA01 | 81 | 207 |
| 2hdoA02 | 17 | 80 |
There are 27 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.23.1.1.1.1 (SIMAX score < 5)
>pdb|2hdoA01 TYQALFDIDGTLTNIELYPGITSLFEQLPSELRLGIVTSQRRNELESGRSYPFRAVTISADDTPKRKPDPLPLLTALEKV NVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGDPNADHQKVAHRFQKPLDILELF
obvious homology
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 177 results for 2hdoA01
SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.
SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.
SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.
SSAP= 90, OV= 88, Seq sim= 27. Very similar linkage, share same function as phosphoglycolate phosphatase.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2hdoA01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hdoA01
Retrieved PRC_PFAMCATH results for job ID SID4188228178079360 and results inserted.
PRC_PFAMCATH job SID4188228178079360 is not yet finished.
The entry "2hdoA01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2hdoA01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID1718689707289160 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1321 results for 2hdoA01
SSAP job SID1718689707289160 is not yet finished.
The entry "2hdoA01" has been submitted to the SSAP webservice.
The entry "2hdoA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID5775719777853150 because submission time of Tue Aug 21 10:49:34 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:32:07 2007).
SSAP job SID5775719777853150 is not yet finished.
The entry "2hdoA01" has been submitted to the SSAP webservice.
The entry "2hdoA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9618229802590780 because submission time of Sun Aug 19 07:26:49 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:10:14 2007).
SSAP job SID9618229802590780 is not yet finished.
The entry "2hdoA01" has been submitted to the SSAP webservice.
The entry "2hdoA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6309830007420480 because submission time of Thu Aug 16 23:19:43 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:28:33 2007).
SSAP job SID6309830007420480 is not yet finished.
The entry "2hdoA01" has been submitted to the SSAP webservice.
The entry "2hdoA01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID3703274574486772 because submission time of Tue Aug 14 08:52:27 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:58 2007).
SSAP job SID3703274574486772 is not yet finished.
The entry "2hdoA01" has been submitted to the SSAP webservice.
The entry "2hdoA01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID5461859815910108 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 37 results for 2hdoA01
The entry "2hdoA01" has been submitted to the PRC webservice.
The entry "2hdoA01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID1895388058109544 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 27 results for 2hdoA01
HMM(SAM) job SID1895388058109544 is not yet finished.
The entry "2hdoA01" has been submitted to the HMM (SAM) webservice.
The entry "2hdoA01" has been submitted to the HMM (SAM) webservice.
Retrieved "2hdoA01" CATHEDRAL results for job ID SID6780992225360268 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 469 results for 2hdoA01
"2hdoA01" CATHEDRAL job SID6780992225360268 is not yet finished.
The entry "2hdoA01" has been submitted to the CATHEDRAL webservice.
The entry "2hdoA01" has been submitted to the CATHEDRAL webservice.
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA01.scanlist" for "2hdoA01"
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA01.scanlist" for domain "2hdoA01"
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.
Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2hdoA01" ready to be processed
NW result present for Domain "2hdoA01"
All required files are present for Domain "2hdoA01"
Beginning processing for Domain "2hdoA01"
nice chopping