CATH Domain: 2hdoA01 XML data for domain: 2hdoA01

Molscript image for 2hdoA01
2hdoA01
PDB coordinates for domain 2hdoA01

PDB 2hdo, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.23
3.40.50.1000.23.1
3.40.50.1000.23.1.1
3.40.50.1000.23.1.1.1
3.40.50.1000.23.1.1.1.1

Segment boundaries for domain 2hdoA01

Chopping figure for domain 2hdoA01
DomainStart PDB ResidueStop PDB Residue
2hdoA01 2 16
2hdoA01 81 207
2hdoA02 17 80

Structural Neighbourhood (27 entries)

There are 27 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.23.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 27 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d6jA01 89.93 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 29 93 1.72 1.84
2nyvA01 89.61 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 27 88 1.95 2.20
3e58B01 88.73 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 20 93 2.00 2.14
2ah5A01 88.73 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 26 92 1.90 2.06
2hszA01 88.72 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 26 90 1.76 1.94
2fdrA01 87.78 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 19 86 2.13 2.46
2fi1A01 87.27 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 24 85 2.04 2.40
3ed5A01 86.43 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 23 91 2.30 2.52
1te2A01 85.80 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 19 92 2.56 2.78
2b0cA01 84.85 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 13 91 2.77 3.04
3i28A01 84.13 PeroxisomeSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase activityEpoxide hydrolase 2 3.40.50.1000 135 14 88 2.72 3.06
1swvA01 83.55 Bacillus cereusPhosphonoacetaldehyde hydrolase 3.40.50.1000 178 16 75 2.05 2.72
1zjjB01 82.57 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 17 86 2.46 2.85
2i6xA01 82.16 Hydrolase, haloacid dehalogenase-like familyPutative hydrolase of the HAD superfamilyPorphyromonas gingivalis 3.40.50.1000 127 17 85 2.59 3.04
2ho4B01 81.68 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 20 81 2.52 3.11
2p11A01 81.38 Burkholderia xenovorans LB400Putative uncharacterized protein 3.40.50.1000 140 11 84 3.07 3.64
2hx1A01 81.34 Cytophaga hutchinsonii ATCC 33406Possible sugar phosphatase, HAD superfamily 3.40.50.1000 155 21 77 2.79 3.60
3cnhA01 80.88 Hydrolase family proteinPutative hydrolase of the HAD superfamilyDeinococcus radiodurans 3.40.50.1000 114 21 80 2.74 3.40
1wpgA04 80.13 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 11 80 3.72 4.64
3fvvA01 80.01 Bordetella pertussisPutative uncharacterized protein 3.40.50.1000 148 17 83 3.06 3.68
1nf2A01 79.78 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 14 80 2.95 3.65
1u02A01 79.40 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.40.50.1000 149 15 78 3.17 4.04
1cqzA01 79.17 PeroxisomeMus musculusSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase 2 3.40.50.1000 162 15 75 2.81 3.73
3bwvA01 79.14 Putative 5'(3')-deoxyribonucleotidaseStaphylococcus epidermidis ATCC 12228 3.40.50.1000 121 14 81 2.98 3.66
1ltqA02 78.25 Polynucleotide kinaseEnterobacteria phage T4 3.40.50.1000 136 13 77 3.32 4.30
1rkuA01 78.00 Glycine, serine and threonine metabolismMetabolic pathwaysPhosphoserine / homoserine phosphotransferase [EC:3.1.3.3 2.7.1.39]Pseudomonas aeruginosaHomoserine kinase 3.40.50.1000 111 15 73 2.99 4.09
3gygC01 75.48 Bacillus subtilisNTD biosynthesis operon putative hydrolase ntdB 3.40.50.1000 191 18 67 3.29 4.91
Displaying entries 1 to 27 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hdoA01
TYQALFDIDGTLTNIELYPGITSLFEQLPSELRLGIVTSQRRNELESGRSYPFRAVTISADDTPKRKPDPLPLLTALEKV
NVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGDPNADHQKVAHRFQKPLDILELF    

Domain COMBS Sequence

>pdb|2hdoA01
GXTYQALXFDIDGTLTNIELYPGITSLFEQLPSELRLGIVTSQRRNELESGXRSYPFXXRXAVTISADDTPKRKPDPLPL
LTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGXDPNADHQKVAHRFQKPLDILELFK    

Domain History Events (214)

Domain assigned by cuff on 07 Feb 2008 13:07

obvious homology

Domain scan prc pfamcath by auto on 25 Sep 2007 12:31

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 177 results for 2hdoA01

Domain assignment manual match h by tronnberg on 05 Sep 2007 12:10

SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.

Homcheck review by tronnberg on 05 Sep 2007 12:10

SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.

Flow stage update by tronnberg on 05 Sep 2007 12:10

SSAP: 80.14 OV: 81 SEQ: 14. Similar function. Share same function as phosphoglycolate phosphatase. I think that 2nyvA01 (TBA) should be assaign into the same homology family for reasons that been stated earlier.

Domain assignment manual match h by tronnberg on 28 Aug 2007 14:41

SSAP= 90, OV= 88, Seq sim= 27. Very similar linkage, share same function as phosphoglycolate phosphatase.

Homcheck allotment by tronnberg on 28 Aug 2007 14:38

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 14:38

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 Aug 2007 11:06

Domain "2hdoA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 25 Aug 2007 11:05

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hdoA01

Flow stage update by auto on 25 Aug 2007 10:48

Retrieved PRC_PFAMCATH results for job ID SID4188228178079360 and results inserted.

Update comment by auto on 25 Aug 2007 03:34

PRC_PFAMCATH job SID4188228178079360 is not yet finished.

Flow stage update by auto on 25 Aug 2007 03:30

The entry "2hdoA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Aug 2007 03:30

The entry "2hdoA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 02:36

Retrieved SSAP results for job ID SID1718689707289160 and results inserted.

Domain scan ssap cath by auto on 25 Aug 2007 02:34

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1321 results for 2hdoA01

Update comment by auto on 23 Aug 2007 22:41

SSAP job SID1718689707289160 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:29

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:29

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:32

Giving up on SSAP job SID5775719777853150 because submission time of Tue Aug 21 10:49:34 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:32:07 2007).

Update comment by auto on 21 Aug 2007 11:32

SSAP job SID5775719777853150 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:49

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:49

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:10

Giving up on SSAP job SID9618229802590780 because submission time of Sun Aug 19 07:26:49 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:10:14 2007).

Update comment by auto on 19 Aug 2007 08:21

SSAP job SID9618229802590780 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:26

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:26

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:28

Giving up on SSAP job SID6309830007420480 because submission time of Thu Aug 16 23:19:43 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:28:33 2007).

Update comment by auto on 17 Aug 2007 00:29

SSAP job SID6309830007420480 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:19

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:19

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:26

Giving up on SSAP job SID3703274574486772 because submission time of Tue Aug 14 08:52:27 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:58 2007).

Update comment by auto on 14 Aug 2007 10:27

SSAP job SID3703274574486772 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:52

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:52

The entry "2hdoA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:15

Retrieved PRC results for job ID SID5461859815910108 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:14

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 37 results for 2hdoA01

Flow stage update by auto on 13 Aug 2007 10:16

The entry "2hdoA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:16

The entry "2hdoA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 06:46

Retrieved HMM(SAM) results for job ID SID1895388058109544 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 06:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 27 results for 2hdoA01

Update comment by auto on 12 Aug 2007 12:59

HMM(SAM) job SID1895388058109544 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:41

The entry "2hdoA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:41

The entry "2hdoA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 02:06

Retrieved "2hdoA01" CATHEDRAL results for job ID SID6780992225360268 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 02:04

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 469 results for 2hdoA01

Update comment by auto on 11 Aug 2007 05:44

"2hdoA01" CATHEDRAL job SID6780992225360268 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:06

The entry "2hdoA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:06

The entry "2hdoA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:59

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA01.scanlist" for "2hdoA01"

Write scan list by auto on 11 Aug 2007 01:59

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hdoA01.scanlist" for domain "2hdoA01"

Update comment by auto on 10 Aug 2007 14:31

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:45

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:31

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:56

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:56

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:42

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:49

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:32

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:41

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:02

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:48

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:54

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:43

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:30

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:11

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:41

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:53

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:47

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:35

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:48

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:42

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:20

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:14

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:12

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:02

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:18

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:09

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:48

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:04

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:06

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:06

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:57

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:06

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:53

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:50

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:45

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:57

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:59

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:58

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:44

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:27

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:20

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:01

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:00

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:59

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:41

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:30

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:02

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:53

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:54

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:59

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:40

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:58

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:49

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:07

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:22

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:27

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:29

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:51

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:24

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:02

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:29

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:31

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:31

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:29

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:38

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:12

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:06

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:07

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:09

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:13

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:48

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:06

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:00

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:55

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:58

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:49

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:15

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:37

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 16:00

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:32

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:36

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:46

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 01:00

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:33

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:16

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:17

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:08

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:55

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:24

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:23

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:18

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:21

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:14

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:12

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:31

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:20

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:27

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:30

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:46

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:47

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:44

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:41

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:33

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:56

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:35

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:35

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:39

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:40

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:33

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:57

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:32

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:04

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:53

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:27

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:16

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:12

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:24

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:52

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:56

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:43

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:23

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:41

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:04

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:21

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:16

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:38

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:36

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:57

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:13

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:17

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:18

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:24

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:25

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:07

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:32

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:48

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:07

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:47

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:51

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:29

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:02

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:49

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:41

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:06

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:32

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:36

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:23

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:23

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:14

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:06

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:13

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:04

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:49

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hdoA01" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hdoA01"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hdoA01"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hdoA01"

Insertion by cuff on 06 Jul 2007 12:33

nice chopping