CATH Domain: 2hcfA01 XML data for domain: 2hcfA01

Molscript image for 2hcfA01
2hcfA01
PDB coordinates for domain 2hcfA01

PDB 2hcf, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.16
3.40.50.1000.16.1
3.40.50.1000.16.1.1
3.40.50.1000.16.1.1.1
3.40.50.1000.16.1.1.1.1

Segment boundaries for domain 2hcfA01

Chopping figure for domain 2hcfA01
DomainStart PDB ResidueStop PDB Residue
2hcfA01 2 18
2hcfA01 87 229
2hcfA02 19 86

Structural Neighbourhood (37 entries)

There are 37 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.16.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 37 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ah5A01 87.54 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 29 88 1.87 2.11
2hszA01 87.26 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 25 89 1.96 2.18
2nyvA01 86.61 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 19 91 2.29 2.50
3d6jA01 86.02 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 18 84 2.01 2.38
1te2A01 85.41 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 19 87 2.20 2.51
3ed5A01 84.82 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 19 85 2.34 2.74
2fdrA01 84.26 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 19 87 2.15 2.47
2fi1A01 83.48 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 21 75 2.17 2.89
1zjjB01 83.39 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 24 87 2.84 3.23
2ho4B01 83.04 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 21 86 2.32 2.69
2pkeA01 82.97 Xanthomonas campestris pv. campestrisPutative hydrolase of the HAD superfamilyHydrolase, haloacid delahogenase-like family 3.40.50.1000 152 17 83 2.96 3.52
3e58B01 82.89 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 19 83 2.22 2.66
2hx1A01 82.78 Cytophaga hutchinsonii ATCC 33406Possible sugar phosphatase, HAD superfamily 3.40.50.1000 155 16 83 2.60 3.10
2hdoA01 82.74 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 3.40.50.1000 134 24 82 2.46 2.97
1swvA01 82.64 Bacillus cereusPhosphonoacetaldehyde hydrolase 3.40.50.1000 178 16 80 2.99 3.70
2qltA01 82.47 Response to osmotic stressNucleusProtein bindingMetabolic pathwaysCytoplasm 3.40.50.1000 171 16 86 4.06 4.69
1u7pD00 82.35 Mus musculusMagnesium-dependent phosphatase 1 3.40.50.1000 161 18 80 2.82 3.52
2p11A01 82.20 Burkholderia xenovorans LB400Putative uncharacterized protein 3.40.50.1000 140 14 82 2.59 3.16
2b0cA01 80.81 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 15 81 3.08 3.78
3fvvA01 79.99 Bordetella pertussisPutative uncharacterized protein 3.40.50.1000 148 16 82 3.02 3.65
3i28A01 79.88 PeroxisomeSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase activityEpoxide hydrolase 2 3.40.50.1000 135 14 80 3.29 4.07
1wpgA04 79.80 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 12 82 3.31 4.03
1u02A01 79.76 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.40.50.1000 149 16 81 3.62 4.45
1nf2A01 79.33 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 17 86 3.14 3.61
1cqzA01 79.29 PeroxisomeMus musculusSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase 2 3.40.50.1000 162 12 80 3.73 4.61
3dnpA01 79.06 Stress response protein yhaXBacillus subtilis 3.40.50.1000 144 13 82 3.44 4.19
2pr7A00 78.56 Corynebacterium glutamicumHaloacid dehalogenase/epoxide hydrolase family 3.40.50.1000 131 11 77 3.29 4.24
1rkuA01 78.04 Glycine, serine and threonine metabolismMetabolic pathwaysPhosphoserine / homoserine phosphotransferase [EC:3.1.3.3 2.7.1.39]Pseudomonas aeruginosaHomoserine kinase 3.40.50.1000 111 16 65 2.55 3.90
2i6xA01 77.70 Hydrolase, haloacid dehalogenase-like familyPutative hydrolase of the HAD superfamilyPorphyromonas gingivalis 3.40.50.1000 127 11 76 3.01 3.95
1ltqA02 77.48 Polynucleotide kinaseEnterobacteria phage T4 3.40.50.1000 136 15 71 3.26 4.54
3bwvA01 77.37 Putative 5'(3')-deoxyribonucleotidaseStaphylococcus epidermidis ATCC 12228 3.40.50.1000 121 13 74 2.89 3.89
3cnhA01 77.12 Hydrolase family proteinPutative hydrolase of the HAD superfamilyDeinococcus radiodurans 3.40.50.1000 114 18 70 2.67 3.79
1rlmA01 77.02 Sugar phosphatase supHSugar-phosphatase [EC:3.1.3.23]Escherichia coli K-12 3.40.50.1000 162 13 87 4.14 4.76
3gygC01 75.51 Bacillus subtilisNTD biosynthesis operon putative hydrolase ntdB 3.40.50.1000 191 14 73 3.21 4.35
1kjnA00 75.33 Methanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.50.10160 148 6 78 3.47 4.40
2qr3A00 73.96 Bacteroides fragilisTwo-component system response regulator 3.40.50.2300 119 9 64 3.23 4.99
2rjnA00 73.52 Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomainNeptuniibacter caesariensis 3.40.50.2300 135 9 65 3.22 4.92
Displaying entries 1 to 37 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hcfA01
SRTLVLFDIDGTLLKVERREDITLLEGVRELLDALSSRSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALDRN
ELPHIALERARRTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTEELARHKPGTLFKNFAETDEVLASILT    

Domain COMBS Sequence

>pdb|2hcfA01
GXSRTLVLFDIDGTLLKVERREDITLLEGVRELLDALSSRSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALD
RNELPHIALERARRXTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTXEELARHKPGTLFKNFAETDEVLASI
LTPKHS    

Domain History Events (218)

Domain assigned by cuff on 04 Feb 2008 14:05

same superfamily. SCOP concurs

Domain assignment manual match h by tronnberg on 26 Nov 2007 09:22

Same superfamily

Homcheck review by tronnberg on 26 Nov 2007 09:22

Same superfamily

Flow stage update by tronnberg on 26 Nov 2007 09:22

Same superfamily

Homcheck return by cuff on 19 Nov 2007 11:04

same family in SCOP. Def same superfamily in CATH

Flow stage update by cuff on 19 Nov 2007 11:04

same family in SCOP. Def same superfamily in CATH

Domain scan prc pfamcath by auto on 25 Sep 2007 12:30

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 263 results for 2hcfA01

Domain assignment manual match t by tronnberg on 28 Aug 2007 12:40

SSAP= 85, OV= 87, Seq sim= 19. Similar linkage, different function.

Homcheck review by tronnberg on 28 Aug 2007 12:40

SSAP= 85, OV= 87, Seq sim= 19. Similar linkage, different function.

Flow stage update by tronnberg on 28 Aug 2007 12:40

SSAP= 85, OV= 87, Seq sim= 19. Similar linkage, different function.

Homcheck allotment by tronnberg on 28 Aug 2007 12:35

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 12:35

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 Aug 2007 11:04

Domain "2hcfA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 25 Aug 2007 11:04

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hcfA01

Flow stage update by auto on 25 Aug 2007 10:47

Retrieved PRC_PFAMCATH results for job ID SID4540649593562132 and results inserted.

Update comment by auto on 25 Aug 2007 03:33

PRC_PFAMCATH job SID4540649593562132 is not yet finished.

Flow stage update by auto on 25 Aug 2007 03:29

The entry "2hcfA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Aug 2007 03:29

The entry "2hcfA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 02:31

Retrieved SSAP results for job ID SID9117583984909600 and results inserted.

Domain scan ssap cath by auto on 25 Aug 2007 02:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1651 results for 2hcfA01

Update comment by auto on 23 Aug 2007 22:41

SSAP job SID9117583984909600 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:29

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:29

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:31

Giving up on SSAP job SID4693821842517136 because submission time of Tue Aug 21 10:49:13 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:31:49 2007).

Update comment by auto on 21 Aug 2007 11:31

SSAP job SID4693821842517136 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:49

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:49

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:09

Giving up on SSAP job SID7672642211053494 because submission time of Sun Aug 19 07:26:20 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:09:54 2007).

Update comment by auto on 19 Aug 2007 08:21

SSAP job SID7672642211053494 is not yet finished.

Flow stage update by auto on 19 Aug 2007 07:26

The entry "2hcfA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 19 Aug 2007 07:26

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:28

Giving up on SSAP job SID6510387237455088 because submission time of Thu Aug 16 23:19:17 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:28:12 2007).

Update comment by auto on 17 Aug 2007 00:28

SSAP job SID6510387237455088 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:19

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:19

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:26

Giving up on SSAP job SID9654428431916064 because submission time of Tue Aug 14 08:51:57 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:37 2007).

Update comment by auto on 14 Aug 2007 10:27

SSAP job SID9654428431916064 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:51

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:51

The entry "2hcfA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:11

Retrieved PRC results for job ID SID0391297946612872 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2hcfA01

Flow stage update by auto on 13 Aug 2007 10:15

The entry "2hcfA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:15

The entry "2hcfA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 06:43

Retrieved HMM(SAM) results for job ID SID9455642044354148 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 06:42

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 32 results for 2hcfA01

Update comment by auto on 12 Aug 2007 12:59

HMM(SAM) job SID9455642044354148 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:40

The entry "2hcfA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:40

The entry "2hcfA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 02:00

Retrieved "2hcfA01" CATHEDRAL results for job ID SID6760590273590448 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 01:59

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2hcfA01

Update comment by auto on 11 Aug 2007 05:43

"2hcfA01" CATHEDRAL job SID6760590273590448 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:06

The entry "2hcfA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:06

The entry "2hcfA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:58

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hcfA01.scanlist" for "2hcfA01"

Write scan list by auto on 11 Aug 2007 01:58

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hcfA01.scanlist" for domain "2hcfA01"

Update comment by auto on 10 Aug 2007 14:31

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:31

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:45

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:31

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:56

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:56

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:42

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:49

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:32

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:40

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:02

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:48

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:54

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:43

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:30

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:11

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:41

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:53

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:47

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:35

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:48

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:42

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:19

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:14

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:12

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:02

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:18

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:09

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:48

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:04

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:06

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:06

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:57

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:06

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:53

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:49

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:45

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:57

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:59

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:58

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:44

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:27

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:20

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:01

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:00

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:59

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:41

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:30

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:01

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:52

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:54

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:59

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:40

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:58

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:49

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:07

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:22

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:27

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:29

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:51

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:24

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:02

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:29

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:31

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:30

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:29

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:38

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:12

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:06

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:06

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:08

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:13

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:48

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:06

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:00

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:55

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:57

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:49

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:15

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:37

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 16:00

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:32

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:35

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:46

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 01:00

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:33

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:16

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:16

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:08

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:55

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:23

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:22

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:18

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:21

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:14

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:11

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:30

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:20

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:27

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:30

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:46

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:47

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:44

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:41

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:33

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:55

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:35

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:34

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:39

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:40

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:32

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:56

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:32

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:03

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:53

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:26

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:15

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:11

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:23

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:51

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:55

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:42

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:23

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:41

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:04

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:21

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:16

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:38

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:35

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:57

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:12

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:16

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:18

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:24

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:25

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:06

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:32

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:48

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:06

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:47

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:51

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:29

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:02

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:49

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:41

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:05

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:32

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:36

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:22

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:23

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:13

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:06

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:13

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:04

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:49

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hcfA01" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hcfA01"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hcfA01"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hcfA01"

Insertion by cuff on 06 Jul 2007 13:31

nice chopping