CATH Domain: 2hc9A02 XML data for domain: 2hc9A02

Molscript image for 2hc9A02
2hc9A02
PDB coordinates for domain 2hc9A02

PDB 2hc9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.17
3.40.630.10.17.1
3.40.630.10.17.1.1
3.40.630.10.17.1.1.1
3.40.630.10.17.1.1.1.1

Segment boundaries for domain 2hc9A02

Chopping figure for domain 2hc9A02
DomainStart PDB ResidueStop PDB Residue
2hc9A01 2 155
2hc9A02 156 490

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2hc9A02
TNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVV
LSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANK
PDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKA
SGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPAL
FSTLLGKYTSVPMLK    

Domain COMBS Sequence

>pdb|2hc9A02
TNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVV
LSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANK
PDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKA
SGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPAL
FSTLLGKYTSVPMLKQ    

Domain History Events (13)

Domain assigned by auto on 14 Jan 2008 17:24

Assigning to "3.40.630.10" based on similarity with "2hb6A02"

Flow stage update by auto on 14 Jan 2008 17:18

No in_process hits for Domain "2hc9A02" ready to be processed

Update comment by auto on 14 Jan 2008 17:05

Domain "2hc9A02" hits Domain "2hb6A02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:09

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:25

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2hc9A02" hits Domain "2hb6B02" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hc9A02"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hc9A02"

Flow stage update by auto on 06 Jul 2007 16:20

Beginning processing for Domain "2hc9A02"

Insertion by auto on 06 Jul 2007 16:01

Final ChopClose added based on similarity with "2hb6A"