CATH Domain: 2hc1A00 XML data for domain: 2hc1A00

Molscript image for 2hc1A00
2hc1A00
PDB coordinates for domain 2hc1A00

PDB 2hc1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.190 Protein-Tyrosine Phosphatase; Chain A
3.90.190.10 Protein tyrosine phosphatase superfamily Gene3D
3.90.190.10.3
3.90.190.10.3.1
3.90.190.10.3.1.1
3.90.190.10.3.1.1.1
3.90.190.10.3.1.1.1.1

Segment boundaries for domain 2hc1A00

Chopping figure for domain 2hc1A00
DomainStart PDB ResidueStop PDB Residue
2hc1A00 1676 1970

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.90.190.10.3.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ooqA00 89.10 Cell surfaceDelta-catenin bindingPlasma membraneHomophilic cell adhesionReceptor-type tyrosine-protein phosphatase T 3.90.190.10 276 44 89 2.26 2.53
2cm2A00 87.96 Insulin signaling pathwayAdherens junctionZinc ion bindingProtein tyrosine phosphatase activityProtein tyrosine phosphatase, non-receptor type 1 [EC:3.1.3.48] 3.90.190.10 283 38 89 2.70 3.03
3b7oA00 87.71 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.90.190.10 266 35 87 3.37 3.86
2cjzA00 87.66 Protein dephosphorylationTyrosine-protein phosphatase non-receptor type 5Protein tyrosine phosphatase activityHomo sapiensPhosphotyrosine binding 3.90.190.10 275 30 86 2.15 2.47
1p15B00 87.51 Mus musculusProtein phosphorylationReceptor-type tyrosine-protein phosphatase alphaInsulin receptor signaling pathway 3.90.190.10 246 36 85 1.89 2.21
2i1yA00 86.82 Protein tyrosine phosphatase, receptor type, N [EC:3.1.3.48]Transmembrane receptor protein tyrosine phosphatase activityType I diabetes mellitusIntegral to plasma membraneHomo sapiens 3.90.190.10 285 34 89 4.24 4.74
1g4wR02 80.78 Salmonella enterica subsp. enterica serovar TyphimuriumSecreted effector protein sptPSecreted effector protein SptPProtein binding 3.90.190.10 221 18 74 2.78 3.73
Displaying entries 1 to 7 (page 1 of 1)


Domain ATOM Sequence

>pdb|2hc1A00
NRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYINA
SYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPE
WTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRI
LQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR    

Domain COMBS Sequence

>pdb|2hc1A00
SNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYIN
ASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLP
EWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR    

Domain History Events (13)

Domain assigned by auto on 24 Nov 2007 03:34

Assigning to "3.90.190.10" based on similarity with "2h03A00"

Flow stage update by auto on 24 Nov 2007 03:33

No in_process hits for Domain "2hc1A00" ready to be processed

Update comment by auto on 24 Nov 2007 03:28

Domain "2hc1A00" hits Domain "2h02A00" (98.2817869415808% over 97.2972972972973%) which is currently in process

Update comment by auto on 24 Nov 2007 03:17

Domain "2hc1A00" hits Domain "2h02B00" (97.9381443298969% over 97.2881355932203%) which is currently in process

Update comment by auto on 24 Nov 2007 03:11

Domain "2hc1A00" hits Domain "2h04A00" (98.2817869415808% over 97.2972972972973%) which is currently in process

Update comment by auto on 24 Nov 2007 03:04

Domain "2hc1A00" hits Domain "2h03A00" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 02:49

Domain "2hc1A00" hits Domain "2ahsA00" (95.8762886597938% over 97.9661016949153%) which is currently in process

Update comment by auto on 23 Nov 2007 14:11

Domain "2hc1A00" hits Domain "1wchA00" (35.7388316151203% over 91.1111111111111%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:05

Domain "2hc1A00" hits Domain "1wchA00" (35.7388316151203% over 91.1111111111111%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:03

NW result present for Domain "2hc1A00"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "2hc1A00"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "2hc1A00"

Insertion by auto on 12 Nov 2007 21:44

Final ChopClose added based on similarity with "2h03A"