CATH Domain: 2hboA01 XML data for domain: 2hboA01

Molscript image for 2hboA01
2hboA01
PDB coordinates for domain 2hboA01

PDB 2hbo, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.129 Thiol Ester Dehydrase; Chain A
3.10.129.10 Gene3D
3.10.129.10.22
3.10.129.10.22.1
3.10.129.10.22.1.1
3.10.129.10.22.1.1.1
3.10.129.10.22.1.1.1.1

[top]
Segment boundaries for domain 2hboA01

Chopping figure for domain 2hboA01
DomainStart PDB ResidueStop PDB Residue
2hboA01 12 144

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.10.129.10.22.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1zkiA00 84.86 Pseudomonas aeruginosaPhenylacetic acid degradation proteinPutative uncharacterized protein 3.10.129.10 118 17 89 3.20 3.57
1ixlA00 84.72 Putative uncharacterized protein PH1136Pyrococcus horikoshii 3.10.129.10 127 15 92 4.27 4.60
3b7kB01 83.45 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 140 10 67 1.94 2.86
1njkA00 82.45 Long-chain acyl-CoA thioesterase tesCAcyl-CoA thioesterase activityThioesterase III [EC:3.1.2.-]Fatty acid beta-oxidationEscherichia coli K-12 3.10.129.10 130 7 73 3.13 4.28
2oiwA00 81.12 Geobacillus kaustophilusHypothetical conserved protein 3.10.129.10 129 11 74 2.72 3.66
2hljA01 80.98 Pseudomonas putida KT2440Putative uncharacterized protein 3.10.129.10 132 11 74 2.98 4.01
1tbuB00 80.28 Palmitoyl-CoA hydrolase [EC:3.1.2.2]Protein bindingBiosynthesis of unsaturated fatty acidsPeroxisomal acyl-coenzyme A thioester hydrolase 1Peroxisome 3.10.129.10 98 11 72 2.71 3.75
3b7kC02 76.45 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 110 9 73 3.64 4.93
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hboA01
AIPEGFSQLNWSRGFGRQIGPLFEHREGPGQARLAFRVEEHHTNGLGNCHGGLSFADAWGRIISLQKSYSWVTVRLCDFL
SGAKLGDWVEGEGELISEEDLFTVRGRIWAGERTLITGTGVFKALSAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hboA01
GXSDDLTDAQTAAIPEGFSQLNWSRGFGRQIGPLFEHREGPGQARLAFRVEEHHTNGLGNCHGGXLXSFADXAWGRIISL
QKSYSWVTVRLXCDFLSGAKLGDWVEGEGELISEEDXLFTVRGRIWAGERTLITGTGVFKALSAR
BLAST against CATH

[top]
Domain History Events (218)

Domain assigned by cuff on 14 Jan 2008 15:14

both structural and functional evidence for homology

Domain assignment manual match h by tronnberg on 26 Nov 2007 09:12

Same superfamily

Homcheck review by tronnberg on 26 Nov 2007 09:12

Same superfamily

Flow stage update by tronnberg on 26 Nov 2007 09:12

Same superfamily

Homcheck return by cuff on 19 Nov 2007 11:01

in same family in SCOP. please place in same superfamily

Flow stage update by cuff on 19 Nov 2007 11:01

in same family in SCOP. please place in same superfamily

Domain assignment manual match t by tronnberg on 28 Aug 2007 12:35

SSAP= 86, OV= 87, Seq sim= 22. Similar linkage.

Homcheck review by tronnberg on 28 Aug 2007 12:35

SSAP= 86, OV= 87, Seq sim= 22. Similar linkage.

Flow stage update by tronnberg on 28 Aug 2007 12:35

SSAP= 86, OV= 87, Seq sim= 22. Similar linkage.

Homcheck allotment by tronnberg on 28 Aug 2007 12:33

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 12:33

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 24 Aug 2007 23:34

Domain "2hboA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 24 Aug 2007 23:33

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hboA01

Flow stage update by auto on 24 Aug 2007 23:03

Retrieved PRC_PFAMCATH results for job ID SID9710520328836408 and results inserted.

Domain scan prc pfamcath by auto on 24 Aug 2007 23:02

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2hboA01

Update comment by auto on 24 Aug 2007 19:44

PRC_PFAMCATH job SID9710520328836408 is not yet finished.

Flow stage update by auto on 24 Aug 2007 19:40

The entry "2hboA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 24 Aug 2007 19:40

The entry "2hboA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Aug 2007 18:44

Retrieved SSAP results for job ID SID2131373242820830 and results inserted.

Domain scan ssap cath by auto on 24 Aug 2007 18:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 995 results for 2hboA01

Update comment by auto on 23 Aug 2007 22:41

SSAP job SID2131373242820830 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:29

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:29

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:31

Giving up on SSAP job SID9596147220511808 because submission time of Tue Aug 21 10:48:59 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:31:37 2007).

Update comment by auto on 21 Aug 2007 11:31

SSAP job SID9596147220511808 is not yet finished.

Flow stage update by auto on 21 Aug 2007 10:49

The entry "2hboA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 21 Aug 2007 10:48

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:09

Giving up on SSAP job SID2931239163246981 because submission time of Sun Aug 19 07:26:01 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:09:41 2007).

Update comment by auto on 19 Aug 2007 08:20

SSAP job SID2931239163246981 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:26

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:26

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:27

Giving up on SSAP job SID2737528549167736 because submission time of Thu Aug 16 23:19:01 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:27:56 2007).

Update comment by auto on 17 Aug 2007 00:28

SSAP job SID2737528549167736 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:19

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:19

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:26

Giving up on SSAP job SID5867107337492416 because submission time of Tue Aug 14 08:51:31 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:23 2007).

Update comment by auto on 14 Aug 2007 10:27

SSAP job SID5867107337492416 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:51

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:51

The entry "2hboA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:08

Retrieved PRC results for job ID SID0237680182965012 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:07

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 30 results for 2hboA01

Flow stage update by auto on 13 Aug 2007 10:15

The entry "2hboA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:15

The entry "2hboA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 06:41

Retrieved HMM(SAM) results for job ID SID5787032862673736 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 06:40

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2hboA01

Update comment by auto on 12 Aug 2007 12:59

HMM(SAM) job SID5787032862673736 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:40

The entry "2hboA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:40

The entry "2hboA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 01:56

Retrieved "2hboA01" CATHEDRAL results for job ID SID9027859643616392 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 01:55

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 82 results for 2hboA01

Update comment by auto on 11 Aug 2007 05:43

"2hboA01" CATHEDRAL job SID9027859643616392 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 04:05

The entry "2hboA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 04:05

The entry "2hboA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:57

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hboA01.scanlist" for "2hboA01"

Write scan list by auto on 11 Aug 2007 01:57

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hboA01.scanlist" for domain "2hboA01"

Update comment by auto on 10 Aug 2007 14:31

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:30

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:45

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:31

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:56

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:56

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:42

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:49

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:32

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:40

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:02

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:48

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:54

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:43

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:30

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:11

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:41

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:52

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:47

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:34

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:48

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:42

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:19

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:14

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:11

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:02

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:18

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:09

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:48

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:04

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:06

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:06

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:57

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:06

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:53

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:49

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:45

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:57

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:59

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:58

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:44

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:26

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:20

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:01

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:00

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:59

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:41

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:30

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:01

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:52

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:53

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:58

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:40

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:58

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:49

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:07

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:22

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:26

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:29

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:51

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:24

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:02

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:29

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:31

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:30

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:29

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:37

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:11

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:05

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:06

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:08

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:13

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:48

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:06

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:00

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:54

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:57

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:49

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:15

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:37

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:59

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:32

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:35

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:46

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:59

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:33

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:16

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:16

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:08

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:55

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:23

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:22

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:17

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:21

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:14

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:11

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:30

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:19

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:26

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:30

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:46

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:47

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:43

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:41

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:32

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:55

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:35

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:34

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:39

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:39

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:32

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:56

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:31

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:03

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:52

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:26

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:15

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:11

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:23

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:51

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:55

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:42

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:23

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:40

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:04

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:21

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:15

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:37

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:35

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:57

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:12

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:16

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:17

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:23

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:25

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:06

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:32

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:48

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:06

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:47

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:51

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:29

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:02

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:49

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:41

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:05

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:31

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:36

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:22

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:23

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:13

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:06

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:13

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:04

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:49

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hboA01" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hboA01"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hboA01"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2hboA01"

Insertion by cuff on 06 Jul 2007 12:05

nice chopping