CATH Domain: 2hbaA00 XML data for domain: 2hbaA00

Molscript image for 2hbaA00
2hbaA00
PDB coordinates for domain 2hbaA00

PDB 2hba, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.5 Ribosomal Protein L9; domain 1
3.40.5.10 Ribosomal Protein L9, domain 1 Gene3D
3.40.5.10.1
3.40.5.10.1.1
3.40.5.10.1.1.1
3.40.5.10.1.1.1.1
3.40.5.10.1.1.1.1.1

[top]
Segment boundaries for domain 2hbaA00

Chopping figure for domain 2hbaA00
DomainStart PDB ResidueStop PDB Residue
2hbaA00 1 52

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.5.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hjqA01 82.32 Uncharacterized protein yqbFBacillus subtilis 3.40.5.20 46 10 76 2.20 2.86
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hbaA00
MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hbaA00
MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 23:16

Assigning to "3.40.5.10" based on similarity with "2hvfA00"

Flow stage update by auto on 14 Aug 2007 22:50

No in_process hits for Domain "2hbaA00" ready to be processed

Flow stage update by auto on 27 Jul 2007 18:40

Domain "2hbaA00" hits Domain "2hbbA00" (98.0392156862745% over 98.0769230769231%) which is currently in process

Flow stage update by auto on 27 Jul 2007 18:40

NW result present for Domain "2hbaA00"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2hbaA00"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "2hbaA00"

Insertion by auto on 14 Jul 2007 04:44

Final ChopClose added based on similarity with "2hbaB"