CATH Domain: 2hayB00 XML data for domain: 2hayB00

Molscript image for 2hayB00
2hayB00
PDB coordinates for domain 2hayB00

PDB 2hay, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.109 NADH Oxidase
3.40.109.10 NADH Oxidase Gene3D
3.40.109.10.7
3.40.109.10.7.1
3.40.109.10.7.1.1
3.40.109.10.7.1.1.3
3.40.109.10.7.1.1.3.1

[top]
Segment boundaries for domain 2hayB00

Chopping figure for domain 2hayB00
DomainStart PDB ResidueStop PDB Residue
2hayB00 2 221

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.109.10.7.1.1.3.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2h0uA00 89.55 NAD(P)H-flavin oxidoreductase[EC:1.-.-.-]Helicobacter pylori 3.40.109.10 187 34 88 1.65 1.87
2b67A00 82.77 [EC:1.-.-.-]Nitroreductase family proteinStreptococcus pneumoniae 3.40.109.10 198 14 90 2.82 3.12
1bkjA00 81.08 Vibrio harveyiNADPH-flavin oxidoreductase 3.40.109.10 230 14 75 3.23 4.29
2freA00 79.91 NAD(P)H-flavin oxidoreductaseAgrobacterium tumefaciens str. C58 3.40.109.10 195 17 78 3.80 4.84
2i7hA00 77.24 Nitroreductase familyBacillus cereus ATCC 14579 3.40.109.10 183 14 77 3.42 4.39
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2hayB00
DQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASH
FILLIAEKHARYDSPAIKNSLLRRGIKEGDGLNSRLKLYESFQKEDDADNPRALFDWTAKQTYIALGNTAALLGIDTCPI
EGFHYDKVNHILAKHNVIDLEKEGIASLSLGYRLRDPKHAQVRKPKEEVSVVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2hayB00
SNAXDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLE
TASHFILLIAEKHARYDSPAIKNSLLRRGIKEGDGLNSRLKLYESFQKEDXDXADNPRALFDWTAKQTYIALGNXXXTAA
LLGIDTCPIEGFHYDKVNHILAKHNVIDLEKEGIASXLSLGYRLRDPKHAQVRKPKEEVXSVVK
BLAST against CATH

[top]
Domain History Events (214)

Domain assigned by cuff on 14 Jan 2008 15:49

excellent structural and functional evidence for homology

Domain assignment manual match h by tronnberg on 05 Sep 2007 12:01

SSAP: 85.29 OV: 90 SEQ: 25. Very similar linkage and structure. Have similar function.
MAtch;NAD(p)h\:fmn oxidoreductase
Query; Putative NAD(p)h-flavin oxidoreductase
I believe that 2h0uA00 (TBA) should be assign to the same homolgy family.

Homcheck review by tronnberg on 05 Sep 2007 12:01

SSAP: 85.29 OV: 90 SEQ: 25. Very similar linkage and structure. Have similar function.
MAtch;NAD(p)h\:fmn oxidoreductase
Query; Putative NAD(p)h-flavin oxidoreductase
I believe that 2h0uA00 (TBA) should be assign to the same homolgy family.

Flow stage update by tronnberg on 05 Sep 2007 12:01

SSAP: 85.29 OV: 90 SEQ: 25. Very similar linkage and structure. Have similar function.
MAtch;NAD(p)h\:fmn oxidoreductase
Query; Putative NAD(p)h-flavin oxidoreductase
I believe that 2h0uA00 (TBA) should be assign to the same homolgy family.

Domain assignment manual match h by tronnberg on 28 Aug 2007 12:29

SSAP= 89, OV= 86, Seq sim= 34. Very similar linkage. Share same function as NAD(p)h-flavin oxidoreductase.

Homcheck allotment by tronnberg on 28 Aug 2007 12:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 12:23

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 Aug 2007 11:04

Domain "2hayB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 25 Aug 2007 11:03

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2hayB00

Flow stage update by auto on 25 Aug 2007 10:46

Retrieved PRC_PFAMCATH results for job ID SID0660258407685792 and results inserted.

Domain scan prc pfamcath by auto on 25 Aug 2007 10:45

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 2hayB00

Update comment by auto on 25 Aug 2007 03:33

PRC_PFAMCATH job SID0660258407685792 is not yet finished.

Prc pfamcath submit by auto on 25 Aug 2007 03:29

The entry "2hayB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 03:29

The entry "2hayB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 02:27

Retrieved SSAP results for job ID SID0402095289520256 and results inserted.

Domain scan ssap cath by auto on 25 Aug 2007 02:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 81 results for 2hayB00

Update comment by auto on 23 Aug 2007 22:41

SSAP job SID0402095289520256 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:29

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:29

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:31

Giving up on SSAP job SID2763657897689440 because submission time of Tue Aug 21 10:48:53 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:31:19 2007).

Update comment by auto on 21 Aug 2007 11:31

SSAP job SID2763657897689440 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 10:48

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 10:48

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 08:09

Giving up on SSAP job SID9997357953117432 because submission time of Sun Aug 19 07:25:33 2007 is more than 172800 seconds older than current time (Tue Aug 21 08:09:34 2007).

Update comment by auto on 19 Aug 2007 08:20

SSAP job SID9997357953117432 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:25

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:25

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:27

Giving up on SSAP job SID9935904727976408 because submission time of Thu Aug 16 23:18:39 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:27:32 2007).

Update comment by auto on 17 Aug 2007 00:28

SSAP job SID9935904727976408 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:18

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:18

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:26

Giving up on SSAP job SID4882349667451524 because submission time of Tue Aug 14 08:51:01 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:26:02 2007).

Update comment by auto on 14 Aug 2007 10:26

SSAP job SID4882349667451524 is not yet finished.

Flow stage update by auto on 14 Aug 2007 08:51

The entry "2hayB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 08:51

The entry "2hayB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 05:05

Retrieved PRC results for job ID SID2853072071297904 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 05:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 12 results for 2hayB00

Flow stage update by auto on 13 Aug 2007 10:14

The entry "2hayB00" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 10:14

The entry "2hayB00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 06:38

Retrieved HMM(SAM) results for job ID SID9347769004785388 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 06:38

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 2hayB00

Update comment by auto on 12 Aug 2007 12:58

HMM(SAM) job SID9347769004785388 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 11:39

The entry "2hayB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 11:39

The entry "2hayB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 01:49

Retrieved "2hayB00" CATHEDRAL results for job ID SID7962433607229416 and inserted them into the database.

Domain scan cathedral cath by auto on 12 Aug 2007 01:48

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 174 results for 2hayB00

Update comment by auto on 11 Aug 2007 05:43

"2hayB00" CATHEDRAL job SID7962433607229416 is not yet finished.

Flow stage update by auto on 11 Aug 2007 04:05

The entry "2hayB00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 11 Aug 2007 04:05

The entry "2hayB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:56

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2hayB00.scanlist" for "2hayB00"

Write scan list by auto on 11 Aug 2007 01:56

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2hayB00.scanlist" for domain "2hayB00"

Update comment by auto on 10 Aug 2007 14:31

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:30

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:44

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:45

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:31

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:12

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:56

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:56

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:42

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:49

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:32

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:40

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:40

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:02

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:48

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:54

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:43

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:30

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:11

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:41

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:52

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:47

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:34

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:48

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:41

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:19

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:14

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:11

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:02

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:18

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:09

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:48

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:04

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:06

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:06

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:57

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:05

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:53

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:49

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:45

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:56

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:59

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:58

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:44

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:26

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:19

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 11:00

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 07:00

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:59

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:41

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:30

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 15:01

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:52

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:53

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:58

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:40

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:58

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:49

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:07

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:22

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:26

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:29

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:51

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:23

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 10:02

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:29

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:31

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:30

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:29

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:37

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:11

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:05

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:06

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:08

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:13

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:47

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:06

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 15:00

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:54

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:57

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:48

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:15

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:36

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:59

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:32

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:35

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:45

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:59

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:32

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:16

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:16

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:08

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:55

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:23

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:22

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:17

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:21

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:14

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:11

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:30

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:19

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:26

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:30

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:46

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:46

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:43

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:40

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:32

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:55

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:34

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:34

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:39

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:39

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:32

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:56

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:31

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:03

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:52

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:26

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:15

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:11

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:23

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:51

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:55

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:42

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:22

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:40

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:04

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:20

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:15

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:37

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:35

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:57

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:12

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:16

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:17

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:23

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:24

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:06

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:31

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:48

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:06

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:46

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:51

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:28

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 23:02

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:49

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:40

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:05

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:31

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:35

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:22

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:23

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:13

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:06

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:13

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:04

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Jul 2007 18:49

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Jul 2007 18:43

No in_process hits for Domain "2hayB00" ready to be processed

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2hayB00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2hayB00"

Flow stage update by auto on 06 Jul 2007 18:16

Beginning processing for Domain "2hayB00"

Insertion by auto on 06 Jul 2007 18:00

Final ChopClose added based on similarity with "2hayA"