CATH Domain: 2h8pB02 XML data for domain: 2h8pB02

Molscript image for 2h8pB02
2h8pB02
PDB coordinates for domain 2h8pB02

PDB 2h8p, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.3
2.60.40.10.3.1
2.60.40.10.3.1.1
2.60.40.10.3.1.1.1
2.60.40.10.3.1.1.1.191

Segment boundaries for domain 2h8pB02

Chopping figure for domain 2h8pB02
DomainStart PDB ResidueStop PDB Residue
2h8pB01 1 108
2h8pB02 109 211

Structural Neighbourhood (142 entries)

There are 142 matching structural neighberhood comparisons for CATH ID 2.60.40.10.3.1.1.1.191 (SIMAX score < 5)

Displaying entries 1 to 142 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q0xL02 94.08 Mus musculusIg lambda-1 chain V regionProtein binding 2.60.40.10 100 37 96 1.11 1.16
1fv1B02 89.91 HLA class II histocompatibility antigen, DR beta 5 chainMajor histocompatibility complex, class IIType I diabetes mellitusAutoimmune thyroid diseaseIntestinal immune network for IgA production 2.60.40.10 98 26 95 2.30 2.42
1l6xA02 89.45 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 106 27 94 1.79 1.90
1ow0A02 88.73 Homo sapiensProtein bindingIg alpha-1 chain C region 2.60.40.10 109 22 93 1.81 1.93
1uvqA02 88.63 2.60.40.10 99 22 95 2.17 2.28
1l6xA01 88.50 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 100 23 93 1.73 1.86
1o0vA01 88.29 Homo sapiensIg epsilon chain C region 2.60.40.10 102 22 95 2.24 2.36
3dbxA02 88.24 CD1-2 antigenGallus gallus 2.60.40.10 99 21 93 2.02 2.17
1ncwH02 87.98 2.60.40.10 99 21 95 2.05 2.16
1seqH02 87.79 Rattus norvegicusIghg protein 2.60.40.10 98 20 93 2.20 2.36
2vxvH02 87.44 2.60.40.10 101 23 96 2.29 2.38
3fruA02 87.41 IgG receptor FcRn large subunit p51Beta-2-microglobulin bindingRattus norvegicusHumoral immune responseIgG receptor activity 2.60.40.10 92 17 89 2.09 2.34
2bnuB02 87.31 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 126 23 80 1.85 2.29
1k5nA02 87.27 HLA class I histocompatibility antigen, B-27 alpha chainMembrane fractionDefense responseHomo sapiens 2.60.40.10 95 17 92 2.34 2.54
1t7vA02 87.18 Cell adhesionHomo sapiensZinc-alpha-2-glycoprotein 2.60.40.10 90 20 87 1.83 2.10
3d9aH02 87.07 2.60.40.10 97 19 93 2.29 2.46
3h9yB01 86.98 Homo sapiensIg epsilon chain C region 2.60.40.10 101 14 95 2.25 2.37
3h9yA02 86.91 Homo sapiensIg epsilon chain C region 2.60.40.10 108 21 93 2.24 2.40
3g08A02 86.77 Antigen-presenting glycoprotein CD1d1Endogenous lipid antigen bindingPositive thymic T cell selectionAntigen processing and presentation, exogenous lipid antigen via MHC class IbProtein binding 2.60.40.10 88 21 85 1.87 2.19
1dn0D02 86.39 2.60.40.10 94 18 87 1.82 2.09
1q72H02 86.10 2.60.40.10 89 19 85 2.20 2.58
1mcpH02 86.09 Mus musculusIg heavy chain V region M603 2.60.40.10 99 20 95 2.88 3.03
2bc4D02 86.06 Major histocompatibility complex, class IIType I diabetes mellitusAutoimmune thyroid diseaseIntestinal immune network for IgA productionAllograft rejection 2.60.40.10 107 20 90 3.29 3.63
1hxmB02 85.83 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 105 22 91 1.99 2.18
2bc4A02 85.43 HLA class II histocompatibility antigen, DM alpha chainHomo sapiensProtein binding 2.60.40.10 109 14 88 2.65 3.01
1ow0A01 85.23 Homo sapiensProtein bindingIg alpha-1 chain C region 2.60.40.10 100 19 93 2.66 2.86
1u58A02 85.01 Murine cytomegalovirus (strain K181)Immunoevasin 2.60.40.10 100 13 91 2.63 2.88
1je6A02 84.29 Response to heatMHC class I polypeptide-related sequence BGamma-delta T cell activationImmune response-activating cell surface receptor signaling pathwayResponse to retinoic acid 2.60.40.10 89 21 85 2.35 2.76
2ec8A03 83.39 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 104 16 93 3.34 3.58
1p53A01 82.46 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 98 11 88 3.59 4.07
2rikA01 82.41 TitinOryctolagus cuniculus 2.60.40.10 96 17 83 2.93 3.52
1dr9A02 82.40 Type I diabetes mellitusIntestinal immune network for IgA productionAutoimmune thyroid diseaseAllograft rejectionT-lymphocyte activation antigen CD80 2.60.40.10 95 23 89 2.67 2.99
2bk8A00 82.32 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 97 10 82 2.82 3.42
2a38B01 82.29 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 99 15 84 2.57 3.05
1g1cA00 82.29 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 98 11 84 2.85 3.38
1itbB03 81.95 Platelet-derived growth factor receptor bindingIntegral to plasma membraneHematopoietic cell lineageInterleukin 1 receptor, type IInterleukin-1-mediated signaling pathway 2.60.40.10 112 12 85 3.03 3.54
3b43A02 81.80 TitinOryctolagus cuniculus 2.60.40.10 97 12 83 2.60 3.12
2c5dC01 81.79 Integral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiensTyrosine-protein kinase receptor UFOSignal transduction 2.60.40.10 104 13 90 3.61 3.99
2fbjH02 81.76 Mus musculusIg heavy chain V region J539 2.60.40.10 73 20 67 2.71 4.01
1vcaA02 81.67 Vascular cell adhesion protein 1MicrovillusPositive regulation of T cell proliferationMembrane to membrane dockingLeukocyte transendothelial migration 2.60.40.10 110 12 87 3.94 4.51
1fhgA00 81.63 TelokinMeleagris gallopavo 2.60.40.10 102 13 85 2.76 3.24
2j8hA01 81.58 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 97 16 83 2.52 3.02
2ec8A04 81.38 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Extracellular spaceAcute myeloid leukemia 2.60.40.10 100 12 92 3.51 3.81
2v44A01 81.20 Prion diseasesNeural cell adhesion moleculeNeuron cell-cell adhesionPlasma membraneNeural cell adhesion molecule 2 2.60.40.10 94 17 84 3.33 3.95
1gsmA02 81.02 Membrane fractionMucosal vascular addressin cell adhesion molecule 1Intestinal immune network for IgA productionCell adhesionHomo sapiens 2.60.40.10 116 15 83 3.68 4.40
1zxqA02 80.97 Intercellular adhesion molecule 2Integral to plasma membraneIntercellular adhesion molecule 2Natural killer cell mediated cytotoxicityHomo sapiens 2.60.40.10 107 9 85 3.14 3.69
1vcaA01 80.86 Vascular cell adhesion protein 1MicrovillusPositive regulation of T cell proliferationHeterophilic cell-cell adhesionFilopodium 2.60.40.10 89 19 82 3.69 4.48
2j8hA02 80.70 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 10 80 2.79 3.47
2rikA02 80.66 TitinOryctolagus cuniculus 2.60.40.10 95 16 83 3.44 4.13
1cs6A03 80.60 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 98 15 81 3.17 3.90
2gy5A04 80.58 MicrovillusCell surfaceTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transductionProtein binding 2.60.40.10 99 13 88 3.44 3.90
2gy5A01 80.58 Cell surfaceMicrovillusIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transduction 2.60.40.10 99 11 84 3.34 3.96
1waaC00 80.33 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 93 13 79 3.06 3.85
1iamA02 80.26 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 102 9 89 3.71 4.16
3cmgA04 80.21 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.1560 87 4 75 3.69 4.89
2rikA03 80.15 TitinOryctolagus cuniculus 2.60.40.10 92 11 79 2.79 3.51
2ifgA02 80.09 High affinity nerve growth factor receptorIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiens 2.60.40.10 90 15 83 3.69 4.43
1cs6A04 80.05 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 90 18 78 2.83 3.61
1koaA03 79.86 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 96 11 81 2.92 3.59
1pewA00 79.83 Ig lambda chain V-VI region SUTHomo sapiens 2.60.40.10 108 8 80 3.12 3.87
1bihA03 79.83 Hyalophora cecropiaHemolin 2.60.40.10 100 12 86 3.47 4.02
1qz1A03 79.82 Rattus norvegicusPrion diseasesNeural cell adhesion moleculePlasma membraneFibroblast growth factor receptor binding 2.60.40.10 95 18 80 3.42 4.25
1iilG02 79.65 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 107 12 73 2.90 3.93
1yc7A00 79.60 2.60.40.10 116 8 75 3.29 4.34
1ogaD01 79.58 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 109 9 78 3.29 4.17
1bihA04 79.55 Hyalophora cecropiaHemolin 2.60.40.10 88 14 77 3.02 3.90
1cczA02 79.48 Homo sapiensLymphocyte function-associated antigen 3Protein binding 2.60.40.10 78 12 71 2.50 3.49
2q8bH01 79.46 2.60.40.10 112 10 74 2.99 4.03
1rhfA01 79.46 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 89 14 80 3.79 4.71
1f97A02 79.46 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 105 15 81 3.00 3.66
2ak4D01 79.45 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 114 8 77 3.33 4.31
2ialA01 79.39 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 108 10 80 3.30 4.10
3d9aL01 79.34 2.60.40.10 107 10 79 3.36 4.23
3cafA01 79.21 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 96 13 81 3.62 4.45
1lp9E01 79.03 2.60.40.10 113 7 76 3.22 4.18
2ec8A05 79.00 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Extracellular spaceAcute myeloid leukemia 2.60.40.10 81 11 76 2.76 3.61
2dm2A00 78.83 NucleusHomo sapiensPalladinActin filamentMuscle alpha-actinin binding 2.60.40.10 110 13 80 3.51 4.39
1u3hA00 78.82 Mus musculusTRAV14-3 2.60.40.10 110 11 79 3.44 4.35
1g0dA03 78.82 Protein-glutamine gamma-glutamyltransferase 2Pagrus major 2.60.40.10 110 13 80 3.89 4.86
1vjjA04 78.79 Calcium ion bindingHair follicle morphogenesisGTP bindingExtrinsic to internal side of plasma membraneTransglutaminase 3 [EC:2.3.2.13] 2.60.40.10 97 5 82 3.65 4.43
2cqvA00 78.78 Myosin light chain kinase activityProtein phosphorylationHomo sapiensMyosin light chain kinase, smooth muscle 2.60.40.10 114 16 76 3.13 4.10
1ogaE01 78.78 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 111 12 76 3.75 4.90
1neuA00 78.72 Rattus norvegicusMyelin protein P0 2.60.40.10 115 7 73 2.86 3.92
1f97A01 78.67 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 102 10 80 3.42 4.25
3bfoA00 78.66 T cell receptor signaling pathwayPositive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionNucleus 2.60.40.10 85 7 76 2.99 3.91
1kgcE01 78.64 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 112 10 75 3.54 4.66
1l6zA02 78.63 Mus musculusCarcinoembryonic antigen-related cell adhesion molecule 1 2.60.40.10 96 13 81 3.31 4.07
2otuA00 78.60 2.60.40.10 115 9 76 3.21 4.19
3esuF02 78.59 2.60.40.10 106 6 76 3.64 4.76
1rhfA02 78.58 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 84 10 76 3.42 4.47
1im3D00 78.58 Unique short US2 glycoproteinHuman herpesvirus 5 strain AD169 2.60.40.1200 95 6 85 3.23 3.79
1nezH00 78.57 T-cell surface glycoprotein CD8 alpha chainProtein homodimerization activityHematopoietic cell lineageCD8A antigen, alpha polypeptideT cell receptor signaling pathway 2.60.40.10 120 14 74 3.59 4.84
1mjuH01 78.55 2.60.40.10 115 6 74 2.96 3.96
1witA00 78.50 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 93 6 82 3.37 4.09
1mjuL01 78.48 2.60.40.10 113 11 76 3.50 4.60
1x9qA01 78.45 2.60.40.10 111 12 78 3.48 4.44
2q20A00 78.42 2.60.40.10 105 9 80 3.62 4.53
1oaqL00 78.40 2.60.40.10 110 8 77 3.40 4.40
1nkrA01 78.40 Integral to plasma membraneReceptor activityHomo sapiensNatural killer cell inhibitory signaling pathwayImmune response 2.60.40.10 97 6 85 3.76 4.41
1cs6A02 78.31 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 89 19 78 3.52 4.49
1mfaH01 78.29 2.60.40.10 97 7 71 3.08 4.30
3d9aH01 78.21 2.60.40.10 112 10 75 3.48 4.59
1xauA00 78.15 Integral to plasma membraneReceptor activityNegative regulation of B cell proliferationProtein bindingMus musculus 2.60.40.10 104 9 87 4.12 4.71
2v44A02 78.04 Prion diseasesNeural cell adhesion moleculePlasma membraneNeuron cell-cell adhesionNeural cell adhesion molecule 2 2.60.40.10 93 13 80 2.96 3.68
2vxtH01 78.03 2.60.40.10 113 9 74 3.06 4.12
1gl4B00 78.02 Chondrocyte differentiationCardiac muscle tissue developmentCartilage development involved in endochondral bone morphogenesisProtein localizationBrain development 2.60.40.10 89 10 79 3.45 4.34
2fcbA02 77.94 Low affinity immunoglobulin gamma Fc region receptor II-bHomo sapiensImmune responseSignal transduction 2.60.40.10 87 6 76 3.62 4.73
3d85D02 77.91 2.60.40.10 106 5 88 4.29 4.84
3bp6A00 77.91 Mus musculusExternal side of plasma membraneProgrammed cell death protein 1Programmed cell death protein 1T cell receptor signaling pathway 2.60.40.10 111 9 77 3.36 4.34
1kgcD01 77.82 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 111 9 77 3.45 4.45
1hxmA01 77.75 2.60.40.10 121 8 74 3.60 4.84
2ij0C00 77.67 Homo sapiensT cell receptor beta variable 20/OR9-2 2.60.40.10 118 13 74 3.37 4.52
3b4nA01 77.56 Erwinia chrysanthemiEndo-pectate lyase 2.60.40.10 88 6 76 3.27 4.28
1f2qA02 77.54 High affinity immunoglobulin epsilon receptor subunit alphaIntegral to plasma membraneHomo sapiensFc receptor, IgE, high affinity I, alpha polypeptideAsthma 2.60.40.10 90 10 80 3.73 4.64
1hxmB01 77.53 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 125 14 72 3.26 4.53
1iamA01 77.40 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 83 9 78 3.87 4.93
1mh5B02 77.38 2.60.40.10 52 21 49 1.35 2.75
1n26A01 77.30 Positive regulation of chemokine productionJak-STAT signaling pathwayPositive regulation of smooth muscle cell proliferationResponse to cytokine stimulusAcute-phase response 2.60.40.10 107 11 78 3.62 4.61
1tvdA00 77.29 Homo sapiensHDV103S1 2.60.40.10 116 13 76 3.53 4.60
1t0pB00 77.29 Integral to plasma membraneIntercellular adhesion molecule 3Homo sapiensIntercellular adhesion molecule 3Cell adhesion molecules (CAMs) 2.60.40.10 86 11 80 3.72 4.63
1ncwH01 77.25 2.60.40.10 119 9 74 3.64 4.87
1bihA01 77.10 Hyalophora cecropiaHemolin 2.60.40.10 97 12 83 3.52 4.22
1cidA02 77.06 Rattus norvegicusT-cell surface glycoprotein CD4Hematopoietic cell lineageT cell receptor signaling pathwayAntigen processing and presentation 2.60.40.10 71 8 68 2.94 4.28
2qsqB01 76.81 Carcinoembryonic antigen-related cell adhesion molecule 5Integral to plasma membraneHomo sapiensBasolateral plasma membrane 2.60.40.10 108 4 75 3.34 4.45
1l0qA02 76.37 Methanosarcina mazeiORF492 2.60.40.670 90 5 75 3.56 4.72
1olzA03 76.32 Anti-apoptosisReceptor bindingSemaphorin-4DReceptor activityCell adhesion 2.60.40.10 89 13 75 3.21 4.25
2aepL01 76.31 2.60.40.10 119 11 71 3.44 4.82
1qr4A01 76.24 TenascinGallus gallus 2.60.40.10 87 9 75 3.38 4.48
1bihA02 76.17 Hyalophora cecropiaHemolin 2.60.40.10 106 13 78 3.34 4.27
2ny1B01 76.15 Zinc ion bindingMaintenance of protein location in cellT-cell surface glycoprotein CD4Signal transductionT cell receptor signaling pathway 2.60.40.10 98 11 72 3.17 4.37
2hftA02 75.98 Positive regulation of endothelial cell proliferationTissue factorPositive regulation of platelet-derived growth factor receptor signaling pathwayPositive regulation of angiogenesisProtease binding 2.60.40.10 102 8 72 3.55 4.89
2gysA03 75.55 Jak-STAT signaling pathwayGranulocyte macrophage colony-stimulating factor receptor complexCytokine receptor common subunit betaCytokine receptor common subunit betaApoptosis 2.60.40.10 86 5 74 3.55 4.76
3hn3A02 75.46 Beta-glucuronidaseGlycosaminoglycan degradationGlycosaminoglycan catabolic processMetabolic pathwaysStarch and sucrose metabolism 2.60.40.320 103 3 79 3.88 4.87
2cumA00 75.39 Collagen metabolic processElastic fiber assemblyIntracellularHomo sapiensTenascin-X 2.60.40.10 105 10 76 3.71 4.87
3di2B02 75.29 Interleukin-7 receptor activityRegulation of DNA recombinationInterleukin-7 receptor subunit alphaHomo sapiensCell surface receptor linked signaling pathway 2.60.40.10 103 8 75 3.74 4.94
1eerB02 75.22 Jak-STAT signaling pathwayIntegral to plasma membraneHematopoietic cell lineageErythropoietin receptor activityErythropoietin receptor 2.60.40.10 102 11 79 3.78 4.76
2gy5A02 75.12 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 2.60.40.10 90 4 79 3.95 4.97
1y6kR02 75.06 Interleukin-10 receptor activityPlasma membraneHomo sapiensInterleukin-10 receptor subunit alpha 2.60.40.10 103 2 73 3.59 4.87
1cs6A01 75.06 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 105 13 83 4.08 4.87
1qfoC00 74.75 Mus musculusSialoadhesinProtein binding 2.60.40.10 114 11 77 3.67 4.75
1j8kA00 74.22 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 5 81 3.92 4.82
1l3wA05 72.04 EP-cadherinXenopus laevis 2.60.40.60 107 7 81 4.04 4.97
Displaying entries 1 to 142 (page 1 of 1)


Domain ATOM Sequence

>pdb|2h8pB02
ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYER
HNSYTCEATHKTSTSPIVKSFNR    

Domain COMBS Sequence

>pdb|2h8pB02
ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYER
HNSYTCEATHKTSTSPIVKSFNR    

Domain History Events (82)

Domain assigned by auto on 26 Mar 2009 21:55

Assigning to "2.60.40.10" based on similarity with "2pcpA02"

Flow stage update by auto on 26 Mar 2009 21:54

No in_process hits for Domain "2h8pB02" ready to be processed

Update comment by auto on 26 Mar 2009 21:51

Domain "2h8pB02" hits Domain "2dquL02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 21:49

Domain "2h8pB02" hits Domain "2dqtL02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 21:47

Domain "2h8pB02" hits Domain "2h2pF02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 21:44

Domain "2h8pB02" hits Domain "2h2sD02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 21:42

Domain "2h8pB02" hits Domain "2h2pD02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 21:40

Domain "2h8pB02" hits Domain "2cmrL02" (59% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 21:38

Domain "2h8pB02" hits Domain "2gsiC02" (100% over 99.0384615384615%) which is currently in process

Update comment by auto on 26 Mar 2009 21:35

Domain "2h8pB02" hits Domain "2gsiA02" (100% over 99.0384615384615%) which is currently in process

Update comment by auto on 26 Mar 2009 21:33

Domain "2h8pB02" hits Domain "2gsiE02" (100% over 99.0384615384615%) which is currently in process

Update comment by auto on 26 Mar 2009 21:30

Domain "2h8pB02" hits Domain "2gsiG02" (100% over 99.0384615384615%) which is currently in process

Update comment by auto on 26 Mar 2009 21:28

Domain "2h8pB02" hits Domain "2gk0L02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 21:26

Domain "2h8pB02" hits Domain "2gk0A02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 21:24

Domain "2h8pB02" hits Domain "2gjzL02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 21:16

Domain "2h8pB02" hits Domain "2gjzA02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 21:06

Domain "2h8pB02" hits Domain "2gcyA02" (60.1941747572816% over 99.0384615384615%) which is currently in process

Update comment by auto on 26 Mar 2009 20:47

Domain "2h8pB02" hits Domain "2g60L02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 20:32

Domain "2h8pB02" hits Domain "2g5bE02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 20:23

Domain "2h8pB02" hits Domain "2g5bA02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 20:13

Domain "2h8pB02" hits Domain "2g5bC02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 20:11

Domain "2h8pB02" hits Domain "2g5bG02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 20:08

Domain "2h8pB02" hits Domain "2g2rA02" (99.0291262135922% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 20:06

Domain "2h8pB02" hits Domain "2g2rL02" (99.0291262135922% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 20:04

Domain "2h8pB02" hits Domain "2fx9M02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 19:58

Domain "2h8pB02" hits Domain "2fx9L02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 19:52

Domain "2h8pB02" hits Domain "2fx7L02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 19:48

Domain "2h8pB02" hits Domain "2fx8M02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 19:33

Domain "2h8pB02" hits Domain "2fx8N02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 19:13

Domain "2h8pB02" hits Domain "2fx8O02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 18:48

Domain "2h8pB02" hits Domain "2fx8L02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 18:21

Domain "2h8pB02" hits Domain "2ddqL02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 17:53

Domain "2h8pB02" hits Domain "2fr4A02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 17:31

Domain "2h8pB02" hits Domain "2fr4L02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 17:10

Domain "2h8pB02" hits Domain "2fatL02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 16:48

Domain "2h8pB02" hits Domain "2bdnL02" (100% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 16:26

Domain "2h8pB02" hits Domain "2b2xL02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 16:05

Domain "2h8pB02" hits Domain "2b2xM02" (100% over 97.1698113207547%) which is currently in process

Update comment by auto on 26 Mar 2009 15:43

Domain "2h8pB02" hits Domain "2b1hL02" (38.6138613861386% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 15:21

Domain "2h8pB02" hits Domain "2b1aL02" (38.6138613861386% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 14:59

Domain "2h8pB02" hits Domain "2b0sL02" (38.6138613861386% over 97.0873786407767%) which is currently in process

Update comment by auto on 26 Mar 2009 14:38

Domain "2h8pB02" hits Domain "2arjL02" (84.4660194174757% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 14:16

Domain "2h8pB02" hits Domain "2arjA02" (84.4660194174757% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 13:53

Domain "2h8pB02" hits Domain "2aj3C02" (59.8039215686275% over 99.0291262135922%) which is currently in process

Update comment by auto on 26 Mar 2009 13:31

Domain "2h8pB02" hits Domain "2aj3A02" (59.8039215686275% over 99.0291262135922%) which is currently in process

Update comment by auto on 26 Mar 2009 13:07

Domain "2h8pB02" hits Domain "2aj3E02" (59.8039215686275% over 99.0291262135922%) which is currently in process

Update comment by auto on 26 Mar 2009 12:40

Domain "2h8pB02" hits Domain "2agjL02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:12

Domain "2h8pB02" hits Domain "1bbjA02" (63.1067961165049% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 11:49

Domain "2h8pB02" hits Domain "3c09L02" (60.1941747572816% over 98.0952380952381%) which is currently in process

Update comment by auto on 16 Mar 2009 17:11

Domain "2h8pB02" hits Domain "3c09B02" (60.1941747572816% over 98.0952380952381%) which is currently in process

Update comment by auto on 16 Mar 2009 17:08

Domain "2h8pB02" hits Domain "3bkmL02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 16 Mar 2009 17:06

Domain "2h8pB02" hits Domain "3bkyL02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 17:03

Domain "2h8pB02" hits Domain "3bkjL02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 16 Mar 2009 17:01

Domain "2h8pB02" hits Domain "3baeL02" (100% over 97.0873786407767%) which is currently in process

Update comment by auto on 16 Mar 2009 16:58

Domain "2h8pB02" hits Domain "3b2uO02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:56

Domain "2h8pB02" hits Domain "3b2uR02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:53

Domain "2h8pB02" hits Domain "3b2uD02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:50

Domain "2h8pB02" hits Domain "3b2uK02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:47

Domain "2h8pB02" hits Domain "3b2uU02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:45

Domain "2h8pB02" hits Domain "3b2uX02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:42

Domain "2h8pB02" hits Domain "3b2vL02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:39

Domain "2h8pB02" hits Domain "3b2uG02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:37

Domain "2h8pB02" hits Domain "3b2uL02" (60.1941747572816% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:34

Domain "2h8pB02" hits Domain "2r9hD02" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:31

Domain "2h8pB02" hits Domain "2r9hF02" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:29

Domain "2h8pB02" hits Domain "2r69L02" (98% over 95.1456310679612%) which is currently in process

Update comment by auto on 16 Mar 2009 16:26

Domain "2h8pB02" hits Domain "2r4rL02" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:24

Domain "2h8pB02" hits Domain "2r4sL02" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:21

Domain "2h8pB02" hits Domain "2r29L02" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 16:18

Domain "2h8pB02" hits Domain "2qscL02" (60.1941747572816% over 99.0384615384615%) which is currently in process

Update comment by auto on 16 Mar 2009 16:16

Domain "2h8pB02" hits Domain "2qqkL02" (60.1941747572816% over 97.1698113207547%) which is currently in process

Update comment by auto on 16 Mar 2009 16:13

Domain "2h8pB02" hits Domain "2qqlL02" (60.1941747572816% over 97.1698113207547%) which is currently in process

Update comment by auto on 16 Mar 2009 16:11

Domain "2h8pB02" hits Domain "2qqnL02" (60.1941747572816% over 99.0384615384615%) which is currently in process

Update comment by auto on 16 Mar 2009 16:08

Domain "2h8pB02" hits Domain "2h2sF02" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 20:48

Domain "2h8pB02" hits Domain "2dtgD02" (99.0196078431373% over 98.0582524271845%) which is currently in process

Update comment by auto on 10 Dec 2008 20:30

Domain "2h8pB02" hits Domain "2nr6E02" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 14:32

Domain "2h8pB02" hits Domain "2dtgB02" (100% over 96.1165048543689%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:18

Domain "2h8pB02" hits Domain "2dtgB02" (100% over 96.1165048543689%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2h8pB02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2h8pB02"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2h8pB02"

Insertion by auto on 05 Dec 2008 21:58

Final ChopClose added based on similarity with "1k4cB"