CATH Domain: 2h8pB01 XML data for domain: 2h8pB01

Molscript image for 2h8pB01
2h8pB01
PDB coordinates for domain 2h8pB01

PDB 2h8p, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.4
2.60.40.10.4.1
2.60.40.10.4.1.2
2.60.40.10.4.1.2.1
2.60.40.10.4.1.2.1.7

Segment boundaries for domain 2h8pB01

Chopping figure for domain 2h8pB01
DomainStart PDB ResidueStop PDB Residue
2h8pB01 1 108
2h8pB02 109 211

Structural Neighbourhood (208 entries)

There are 208 matching structural neighberhood comparisons for CATH ID 2.60.40.10.4.1.2.1.7 (SIMAX score < 5)

Displaying entries 1 to 200 (page 1 of 2)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9qA01 94.79 2.60.40.10 111 57 93 0.65 0.69
2q20A00 94.60 2.60.40.10 105 58 96 0.63 0.65
1mjuL01 94.09 2.60.40.10 113 56 94 0.81 0.86
2aepL01 93.88 2.60.40.10 119 56 89 0.66 0.73
1oaqL00 91.76 2.60.40.10 110 38 96 1.83 1.90
1pewA00 91.00 Ig lambda chain V-VI region SUTHomo sapiens 2.60.40.10 108 36 96 1.60 1.66
1ogaD01 90.34 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 109 30 94 2.41 2.55
2ialA01 90.05 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 108 29 93 1.80 1.92
1kgcE01 90.02 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 112 28 92 1.84 1.98
2otuA00 89.49 2.60.40.10 115 39 90 1.75 1.94
1mjuH01 88.96 2.60.40.10 115 20 91 1.82 1.99
3bp6A00 88.81 Mus musculusExternal side of plasma membraneProgrammed cell death protein 1Programmed cell death protein 1T cell receptor signaling pathway 2.60.40.10 111 22 90 1.88 2.07
1ogaE01 88.79 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 111 27 92 1.97 2.12
2q8bH01 88.20 2.60.40.10 112 25 91 1.69 1.86
2vxtH01 88.19 2.60.40.10 113 24 91 2.03 2.23
2ak4D01 88.05 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 114 28 92 3.52 3.79
1u3hA00 88.04 Mus musculusTRAV14-3 2.60.40.10 110 30 91 1.90 2.07
1yc7A00 87.92 2.60.40.10 116 28 89 2.19 2.44
2nw2A01 87.85 TRA@ proteinHomo sapiens 2.60.40.10 103 29 92 3.54 3.83
2ij0C00 87.81 Homo sapiensT cell receptor beta variable 20/OR9-2 2.60.40.10 118 28 89 1.68 1.87
3esuF02 87.36 2.60.40.10 106 18 86 2.21 2.54
1nezH00 87.34 T-cell surface glycoprotein CD8 alpha chainProtein homodimerization activityHematopoietic cell lineageCD8A antigen, alpha polypeptideT cell receptor signaling pathway 2.60.40.10 120 20 87 2.03 2.32
2hp4A00 87.28 T-cell surface glycoprotein CD8 alpha chainCD8A antigen, alpha polypeptideHematopoietic cell lineagePrimary immunodeficiencyHomo sapiens 2.60.40.10 112 20 93 2.30 2.45
2v44A01 87.25 Prion diseasesNeural cell adhesion moleculeNeuron cell-cell adhesionPlasma membraneNeural cell adhesion molecule 2 2.60.40.10 94 23 85 1.85 2.15
1lp9E01 87.22 2.60.40.10 113 26 90 1.96 2.17
1hxmB01 87.21 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 125 28 85 1.74 2.03
1f97A01 86.99 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 102 18 93 1.89 2.02
1kgcD01 86.96 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 111 22 89 2.25 2.52
1tvdA00 86.81 Homo sapiensHDV103S1 2.60.40.10 116 26 91 2.06 2.25
1hxmA01 86.68 2.60.40.10 121 22 88 2.14 2.42
1fo0B00 86.48 2.60.40.10 112 21 91 3.02 3.28
3d9aH01 86.43 2.60.40.10 112 21 91 2.12 2.31
1f3rB02 86.42 2.60.40.10 99 49 77 2.60 3.35
1t2jA00 86.39 Homo sapiensSingle chain Fv 2.60.40.10 116 25 91 2.94 3.22
1qfoC00 86.32 Mus musculusSialoadhesinProtein binding 2.60.40.10 114 16 92 2.74 2.97
2bk8A00 86.21 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 97 17 85 1.95 2.27
1neuA00 86.21 Rattus norvegicusMyelin protein P0 2.60.40.10 115 18 88 1.92 2.16
2a38B01 86.04 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 99 14 86 1.91 2.20
1xauA00 85.99 Integral to plasma membraneReceptor activityNegative regulation of B cell proliferationProtein bindingMus musculus 2.60.40.10 104 13 90 2.49 2.75
1mfaH01 85.95 2.60.40.10 97 20 81 1.79 2.20
2ny1B01 85.93 Zinc ion bindingMaintenance of protein location in cellT-cell surface glycoprotein CD4Signal transductionT cell receptor signaling pathway 2.60.40.10 98 18 85 2.27 2.67
2rikA02 85.92 TitinOryctolagus cuniculus 2.60.40.10 95 18 86 2.33 2.68
1ncwH01 85.91 2.60.40.10 119 27 89 2.14 2.40
2qsqB01 85.65 Carcinoembryonic antigen-related cell adhesion molecule 5Integral to plasma membraneHomo sapiensBasolateral plasma membrane 2.60.40.10 108 15 93 3.15 3.37
2p45B00 85.50 2.60.40.10 116 19 88 3.36 3.78
1fhgA00 85.42 TelokinMeleagris gallopavo 2.60.40.10 102 14 86 2.27 2.61
1qz1A03 85.41 Rattus norvegicusPrion diseasesNeural cell adhesion moleculePlasma membraneFibroblast growth factor receptor binding 2.60.40.10 95 17 85 2.61 3.04
1eajB00 85.33 Integral to plasma membraneReceptor activityCoxsackievirus and adenovirus receptorViral myocarditisCoxsackievirus and adenovirus receptor 2.60.40.10 120 14 87 2.61 2.98
2j8hA01 85.27 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 97 19 87 2.46 2.80
2rikA01 85.25 TitinOryctolagus cuniculus 2.60.40.10 96 16 86 2.16 2.49
1gl4B00 85.22 Chondrocyte differentiationCardiac muscle tissue developmentCartilage development involved in endochondral bone morphogenesisProtein localizationBrain development 2.60.40.10 89 30 81 2.06 2.53
1iilG02 85.19 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 107 19 85 3.12 3.67
2j8hA02 85.17 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 14 85 2.12 2.47
1g1cA00 85.02 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 98 14 86 2.36 2.72
1ypzF01 84.91 2.60.40.10 123 22 86 2.70 3.10
1waaC00 84.88 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 93 12 82 2.09 2.54
1vcaA01 84.86 Vascular cell adhesion protein 1MicrovillusPositive regulation of T cell proliferationHeterophilic cell-cell adhesionFilopodium 2.60.40.10 89 23 82 2.06 2.50
1hkfA00 84.83 Integral to plasma membraneNatural cytotoxicity triggering receptor 2Cellular defense responseNatural killer cell mediated cytotoxicitySignal transduction 2.60.40.10 108 15 93 4.13 4.42
3cafA01 84.77 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 96 16 85 2.34 2.75
2v44A02 84.76 Prion diseasesNeural cell adhesion moleculePlasma membraneNeuron cell-cell adhesionNeural cell adhesion molecule 2 2.60.40.10 93 16 84 2.04 2.43
2ec8A03 84.76 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 104 16 83 2.34 2.81
2q87C00 84.72 Homo sapiensCMRF35-like molecule 8CD300 antigen 2.60.40.10 106 17 90 3.51 3.87
2rikA03 84.70 TitinOryctolagus cuniculus 2.60.40.10 92 19 85 2.10 2.44
2g5rA00 84.59 Sialic acid-binding Ig-like lectin 7Sialic acid binding Ig-like lectin 7Receptor activityIntegral to plasma membraneHomo sapiens 2.60.40.10 113 18 89 2.95 3.30
1bihA01 84.53 Hyalophora cecropiaHemolin 2.60.40.10 97 14 86 2.50 2.88
1l6zA02 84.43 Mus musculusCarcinoembryonic antigen-related cell adhesion molecule 1 2.60.40.10 96 23 85 2.30 2.70
1f97A02 84.42 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 105 18 87 2.40 2.73
3b43A02 84.39 TitinOryctolagus cuniculus 2.60.40.10 97 21 85 2.18 2.54
1pkoA00 84.31 Rattus norvegicusMyelin-oligodendrocyte glycoproteinPositive regulation of MyD88-dependent toll-like receptor signaling pathway 2.60.40.10 123 17 82 2.22 2.68
1cs6A04 84.29 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 90 21 83 2.23 2.68
1cs6A01 84.25 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 105 16 87 3.09 3.52
1bihA03 84.22 Hyalophora cecropiaHemolin 2.60.40.10 100 13 88 3.15 3.55
1cs6A02 84.21 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 89 21 79 2.37 2.98
1bihA04 83.90 Hyalophora cecropiaHemolin 2.60.40.10 88 19 81 2.18 2.68
1cczA01 83.87 Homo sapiensLymphocyte function-associated antigen 3Protein binding 2.60.40.10 93 12 84 2.66 3.16
1rhfA01 83.83 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 89 21 78 2.89 3.68
1dr9A01 83.78 Type I diabetes mellitusAutoimmune thyroid diseaseIntestinal immune network for IgA productionAllograft rejectionT-lymphocyte activation antigen CD80 2.60.40.10 105 12 87 2.76 3.14
1smoB00 83.77 Receptor activityTriggering receptor expressed on myeloid cells 1Homo sapiensHumoral immune response 2.60.40.10 110 13 86 2.92 3.38
1cs6A03 83.64 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 98 22 85 2.72 3.20
1i1rA01 83.63 Jak-STAT signaling pathwayOncostatin-M receptor complexResponse to cytokine stimulusPositive regulation of osteoblast differentiationPositive regulation of tyrosine phosphorylation of Stat1 protein 2.60.40.10 100 11 83 2.64 3.17
1ncnA00 83.58 T-lymphocyte activation antigen CD86Positive regulation of cell proliferationHomo sapiensImmune responseProtein binding 2.60.40.10 110 15 86 2.33 2.70
2ec8A04 83.54 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Extracellular spaceAcute myeloid leukemia 2.60.40.10 100 14 83 2.15 2.58
2cqvA00 83.50 Myosin light chain kinase activityProtein phosphorylationHomo sapiensMyosin light chain kinase, smooth muscle 2.60.40.10 114 14 81 2.06 2.53
1uctA01 83.46 Immunoglobulin alpha Fc receptorIntegral to plasma membraneCD89 antigenHomo sapiensImmune response 2.60.40.10 91 15 83 3.25 3.91
1koaA03 83.45 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 96 23 85 2.36 2.74
2dm2A00 83.37 NucleusHomo sapiensPalladinActin filamentMuscle alpha-actinin binding 2.60.40.10 110 10 85 2.40 2.81
2c5dC01 83.35 Integral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiensTyrosine-protein kinase receptor UFOSignal transduction 2.60.40.10 104 12 84 2.22 2.64
1olzA03 83.35 Anti-apoptosisReceptor bindingSemaphorin-4DReceptor activityCell adhesion 2.60.40.10 89 19 79 2.52 3.17
3k3qA00 83.26 2.60.40.10 137 21 77 2.62 3.39
1itbB03 83.24 Platelet-derived growth factor receptor bindingIntegral to plasma membraneHematopoietic cell lineageInterleukin 1 receptor, type IInterleukin-1-mediated signaling pathway 2.60.40.10 112 12 83 2.42 2.88
1gsmA01 83.16 Membrane fractionMucosal vascular addressin cell adhesion molecule 1Intestinal immune network for IgA productionCell adhesionHomo sapiens 2.60.40.10 90 16 81 3.34 4.11
1nkrA01 83.04 Integral to plasma membraneReceptor activityHomo sapiensNatural killer cell inhibitory signaling pathwayImmune response 2.60.40.10 97 12 84 3.10 3.69
2gy5A02 82.91 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 2.60.40.10 90 14 83 3.28 3.94
1dqtA00 82.88 Mus musculusExternal side of plasma membraneCytotoxic T-lymphocyte protein 4 2.60.40.10 117 17 86 2.63 3.05
2fcbA02 82.82 Low affinity immunoglobulin gamma Fc region receptor II-bHomo sapiensImmune responseSignal transduction 2.60.40.10 87 12 77 2.36 3.04
1f2qA02 82.62 High affinity immunoglobulin epsilon receptor subunit alphaIntegral to plasma membraneHomo sapiensFc receptor, IgE, high affinity I, alpha polypeptideAsthma 2.60.40.10 90 15 79 2.81 3.54
1fltX00 82.54 Vascular endothelial growth factor receptor 1Integral to plasma membraneGrowth factor bindingVascular endothelial growth factor receptor activityFemale pregnancy 2.60.40.10 95 12 84 3.05 3.63
2ec8A01 82.30 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 92 11 72 2.14 2.94
2ifgA02 82.20 High affinity nerve growth factor receptorIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiens 2.60.40.10 90 16 82 3.38 4.11
1rhfA02 82.20 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 84 17 77 2.57 3.31
1zxqA02 82.19 Intercellular adhesion molecule 2Integral to plasma membraneIntercellular adhesion molecule 2Natural killer cell mediated cytotoxicityHomo sapiens 2.60.40.10 107 13 80 2.65 3.30
1ugnA01 82.16 Homo sapiensLeukocyte immunoglobulin-like receptor subfamily B member 1Integral to membraneResponse to virusProtein phosphatase 1 binding 2.60.40.10 95 16 83 3.30 3.97
1iamA01 81.96 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 83 14 75 2.63 3.47
2e9wA01 81.86 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaExtracellular space 2.60.40.10 84 13 72 2.39 3.28
2gy5A04 81.75 MicrovillusCell surfaceTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transductionProtein binding 2.60.40.10 99 12 82 2.18 2.65
2gy5A01 81.72 Cell surfaceMicrovillusIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transduction 2.60.40.10 99 12 84 3.11 3.70
1witA00 81.72 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 93 9 85 3.09 3.63
1bihA02 81.72 Hyalophora cecropiaHemolin 2.60.40.10 106 13 85 2.90 3.41
3bfoA00 81.64 T cell receptor signaling pathwayPositive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionNucleus 2.60.40.10 85 18 78 2.41 3.07
1t0pB00 81.57 Integral to plasma membraneIntercellular adhesion molecule 3Homo sapiensIntercellular adhesion molecule 3Cell adhesion molecules (CAMs) 2.60.40.10 86 9 78 2.54 3.24
2fcbA01 81.33 Low affinity immunoglobulin gamma Fc region receptor II-bHomo sapiensImmune responseSignal transduction 2.60.40.10 86 17 75 2.80 3.70
1nkrA02 81.17 Receptor activityIntegral to plasma membraneHomo sapiensImmune responseNatural killer cell inhibitory signaling pathway 2.60.40.10 98 13 80 2.67 3.32
1cidA01 81.14 Rattus norvegicusT-cell surface glycoprotein CD4Hematopoietic cell lineageT cell receptor signaling pathwayAntigen processing and presentation 2.60.40.10 106 13 88 3.03 3.41
1xiwA00 81.13 Chagas diseaseHematopoietic cell lineageReceptor signaling protein activitySH3 domain bindingT cell receptor signaling pathway 2.60.40.10 91 15 77 3.36 4.33
1iamA02 80.81 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 102 9 84 4.04 4.80
1o0vA01 80.75 Homo sapiensIg epsilon chain C region 2.60.40.10 102 10 81 3.60 4.43
1pd6A00 80.63 Myosin-binding protein C, cardiac-typeHomo sapiensVentricular cardiac muscle tissue morphogenesisStriated muscle myosin thick filamentStructural constituent of muscle 2.60.40.10 94 15 83 3.19 3.84
1hzhH01 80.56 2.60.40.10 119 12 69 2.51 3.60
1q0xL02 80.54 Mus musculusIg lambda-1 chain V regionProtein binding 2.60.40.10 100 10 78 3.11 3.96
1n26A02 80.53 Positive regulation of chemokine productionPositive regulation of smooth muscle cell proliferationJak-STAT signaling pathwayAcute-phase responsePositive regulation of osteoblast differentiation 2.60.40.10 78 28 69 2.55 3.69
1edqA01 80.28 Chitinase ASerratia marcescens 2.60.40.10 107 10 80 3.17 3.94
3b4nA01 80.14 Erwinia chrysanthemiEndo-pectate lyase 2.60.40.10 88 6 78 2.88 3.67
1uvqA02 80.06 2.60.40.10 99 9 75 2.95 3.90
1dr9A02 80.04 Type I diabetes mellitusIntestinal immune network for IgA productionAutoimmune thyroid diseaseAllograft rejectionT-lymphocyte activation antigen CD80 2.60.40.10 95 11 72 3.19 4.38
3h9yA02 79.99 Homo sapiensIg epsilon chain C region 2.60.40.10 108 8 79 3.58 4.50
2bc4A02 79.93 HLA class II histocompatibility antigen, DM alpha chainHomo sapiensProtein binding 2.60.40.10 109 7 76 3.47 4.56
1ow0A02 79.90 Homo sapiensProtein bindingIg alpha-1 chain C region 2.60.40.10 109 10 78 3.34 4.23
1l6xA02 79.86 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 106 11 78 3.63 4.62
1n26A01 79.75 Positive regulation of chemokine productionJak-STAT signaling pathwayPositive regulation of smooth muscle cell proliferationResponse to cytokine stimulusAcute-phase response 2.60.40.10 107 10 82 3.21 3.90
1g0dA03 79.71 Protein-glutamine gamma-glutamyltransferase 2Pagrus major 2.60.40.10 110 2 80 3.79 4.68
1f6fB01 79.65 Rattus norvegicusProlactin receptorProlactin receptor activity 2.60.40.10 97 5 83 3.78 4.54
1p53A01 79.56 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 98 9 79 2.79 3.51
1l6xA01 79.37 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 100 9 76 3.22 4.20
1nctA00 79.27 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 19 85 2.77 3.26
3b9eA01 78.89 Vibrio harveyiChitinase A 2.60.40.10 110 8 78 3.00 3.84
3h9yB01 78.77 Homo sapiensIg epsilon chain C region 2.60.40.10 101 9 79 3.65 4.59
1v05A00 78.73 Plasma membraneFilamin-CHomo sapiens 2.60.40.10 96 7 81 3.69 4.54
1itbB01 78.68 Platelet-derived growth factor receptor bindingIntegral to plasma membraneHematopoietic cell lineageInterleukin 1 receptor, type IInterleukin-1-mediated signaling pathway 2.60.40.10 92 16 85 3.99 4.69
1cwvA03 78.64 InvasinYersinia pseudotuberculosis 2.60.40.920 102 10 80 3.69 4.59
1dn0D02 78.47 2.60.40.10 94 10 71 2.78 3.86
1cfbA01 78.47 Calcium ion bindingNeuron cell-cell adhesionNerve maturationDrosophila melanogasterEpidermal growth factor receptor signaling pathway 2.60.40.10 99 4 81 3.26 4.01
1cczA02 78.47 Homo sapiensLymphocyte function-associated antigen 3Protein binding 2.60.40.10 78 10 71 3.29 4.63
2nqcA00 78.39 Plasma membraneFilamin-CHomo sapiens 2.60.40.10 97 6 81 3.91 4.81
3cmgA04 78.36 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.1560 87 3 76 3.20 4.18
1mcpH02 78.31 Mus musculusIg heavy chain V region M603 2.60.40.10 99 10 76 3.35 4.37
1hxmB02 78.19 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 105 7 78 3.36 4.28
1y6kR02 78.16 Interleukin-10 receptor activityPlasma membraneHomo sapiensInterleukin-10 receptor subunit alpha 2.60.40.10 103 5 70 3.02 4.31
1cwvA02 78.06 InvasinYersinia pseudotuberculosis 2.60.40.920 97 6 79 3.37 4.24
1u2cA01 77.94 Epithelial tube branching involved in lung morphogenesisDilated cardiomyopathyECM-receptor interactionHypertrophic cardiomyopathy (HCM)Sarcolemma 2.60.40.10 103 11 81 3.25 4.00
1clcA01 77.90 Clostridium thermocellumEndoglucanase D 2.60.40.10 102 5 71 2.65 3.73
2vxvH02 77.86 2.60.40.10 101 7 77 3.28 4.23
2nziA03 77.84 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 94 7 80 3.65 4.54
1seqH02 77.80 Rattus norvegicusIghg protein 2.60.40.10 98 6 75 3.63 4.80
3di2B02 77.77 Interleukin-7 receptor activityRegulation of DNA recombinationInterleukin-7 receptor subunit alphaHomo sapiensCell surface receptor linked signaling pathway 2.60.40.10 103 4 80 3.49 4.34
1gsmA02 77.76 Membrane fractionMucosal vascular addressin cell adhesion molecule 1Intestinal immune network for IgA productionCell adhesionHomo sapiens 2.60.40.10 116 14 75 2.88 3.80
1bquA01 77.72 Oncostatin-M receptor complexJak-STAT signaling pathwayResponse to cytokine stimulusPositive regulation of tyrosine phosphorylation of Stat1 proteinPositive regulation of osteoblast differentiation 2.60.40.10 100 6 84 3.80 4.52
3d9aH02 77.70 2.60.40.10 97 8 74 3.61 4.83
2gysB04 77.66 Jak-STAT signaling pathwayCytokine receptor common subunit betaApoptosisCytokine-cytokine receptor interactionGranulocyte macrophage colony-stimulating factor receptor complex 2.60.40.10 99 6 77 3.66 4.72
1qfhA01 77.63 ThermotaxisPhagocytic cupMembrane fractionPhototaxisProtein homodimerization activity 2.60.40.10 111 3 79 3.46 4.36
1ulvA03 77.53 GlucodextranaseArthrobacter globiformis 2.60.40.1560 86 5 74 3.47 4.64
1fyhB02 77.41 Jak-STAT signaling pathwayInterferon gamma receptor 1Integral to plasma membraneChagas diseaseInterferon-gamma receptor activity 2.60.40.10 103 5 85 4.06 4.72
2ec8A02 77.37 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 87 12 77 3.13 4.04
1k3iA03 77.37 Gibberella zeaeGalactose oxidase 2.60.40.10 97 11 75 3.68 4.86
1axiB02 77.32 Jak-STAT signaling pathwayCell surfaceMulticellular organismal metabolic processGrowth hormone receptor complexInsulin-like growth factor receptor signaling pathway 2.60.40.10 101 3 77 3.45 4.45
1y6kR01 77.27 Interleukin-10 receptor activityPlasma membraneHomo sapiensInterleukin-10 receptor subunit alpha 2.60.40.10 102 1 81 3.50 4.30
1p53A03 77.21 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 83 12 74 2.97 3.97
1cd9D01 77.16 Mus musculusGranulocyte colony-stimulating factor receptorNeutrophil chemotaxis 2.60.40.10 107 8 85 4.01 4.72
1ncwH02 77.12 2.60.40.10 99 12 76 3.42 4.46
1l0qA02 77.04 Methanosarcina mazeiORF492 2.60.40.670 90 6 73 2.98 4.04
2gysA02 77.01 Jak-STAT signaling pathwayCytokine receptor common subunit betaApoptosisCytokine-cytokine receptor interactionGranulocyte macrophage colony-stimulating factor receptor complex 2.60.40.10 102 2 81 3.73 4.59
1f6fB02 76.92 Rattus norvegicusProlactin receptorProlactin receptor activity 2.60.40.10 97 3 78 3.39 4.32
1ix2A00 76.89 Escherichia coliCopper resistance protein C 2.60.40.1220 97 5 79 3.50 4.41
1ut9A01 76.87 Clostridium thermocellumCellobiohydrolase 2.60.40.10 98 4 77 3.32 4.28
1ej6A05 76.82 Mammalian orthoreovirus 3 DearingOuter capsid protein lambda-2 2.60.40.10 95 8 82 3.80 4.62
1ujtA00 76.77 LuteolysisPositive regulation of axonogenesisCell surfaceIdentical protein bindingHomophilic cell adhesion 2.60.40.10 120 4 74 3.50 4.72
1fnhA03 76.71 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 89 12 79 3.45 4.34
1t7vA02 76.66 Cell adhesionHomo sapiensZinc-alpha-2-glycoprotein 2.60.40.10 90 11 71 3.55 5.00
1q72H02 76.58 2.60.40.10 89 8 69 3.29 4.76
2cumA00 76.56 Collagen metabolic processElastic fiber assemblyIntracellularHomo sapiensTenascin-X 2.60.40.10 105 2 80 3.57 4.44
1cd9B02 76.54 Mus musculusGranulocyte colony-stimulating factor receptorNeutrophil chemotaxis 2.60.40.10 98 6 81 3.76 4.62
1k5nA02 76.42 HLA class I histocompatibility antigen, B-27 alpha chainMembrane fractionDefense responseHomo sapiens 2.60.40.10 95 7 75 3.61 4.77
2hftA02 76.41 Positive regulation of endothelial cell proliferationTissue factorPositive regulation of platelet-derived growth factor receptor signaling pathwayPositive regulation of angiogenesisProtease binding 2.60.40.10 102 9 75 3.51 4.64
1w8oA02 76.18 Micromonospora viridifaciensSialidase 2.60.40.10 102 10 77 3.44 4.43
1uemA00 76.06 LuteolysisPositive regulation of axonogenesisIdentical protein bindingCell surfaceHomophilic cell adhesion 2.60.40.10 117 5 75 3.61 4.80
1iarB01 76.05 Jak-STAT signaling pathwayInterleukin 4 receptorIntegral to plasma membraneInterleukin-4 receptor activityHematopoietic cell lineage 2.60.40.10 96 8 80 3.73 4.64
3bgaA04 76.03 Galactose metabolismBacteroides thetaiotaomicronBeta-galactosidaseSphingolipid metabolismBeta-galactosidase [EC:3.2.1.23] 2.60.40.320 105 11 75 3.76 4.97
1qg3A01 76.01 Homo sapiensIntegrin beta-4Protein bindingIntegrin complex 2.60.40.10 91 1 79 3.51 4.42
1owwA00 75.93 FibronectinER-Golgi intermediate compartmentPeptide cross-linkingFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 93 6 83 3.69 4.44
2a9dA02 75.72 Sulfite oxidaseGallus gallus 2.60.40.650 123 7 71 2.83 3.96
2xg5A01 75.55 Chaperone protein PapDChaperone protein papDEscherichia coli 2.60.40.360 121 6 79 3.96 4.99
1n26A03 75.55 Positive regulation of chemokine productionJak-STAT signaling pathwayPositive regulation of smooth muscle cell proliferationResponse to cytokine stimulusAcute-phase response 2.60.40.10 104 4 77 3.80 4.90
2ny1B02 75.52 Zinc ion bindingMaintenance of protein location in cellT-cell surface glycoprotein CD4Signal transductionT cell receptor signaling pathway 2.60.40.10 75 14 69 3.23 4.67
1fnfA02 75.48 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 87 6 77 3.63 4.68
1n6uA02 75.47 JAK-STAT cascadeIntegral to plasma membraneType I interferon receptor activityHomo sapiensResponse to virus 2.60.40.10 106 6 85 4.25 5.00
1iarB02 75.43 Jak-STAT signaling pathwayInterleukin 4 receptorIntegral to plasma membraneReceptor signaling protein activityHematopoietic cell lineage 2.60.40.10 92 6 71 3.17 4.41
1j8kA00 75.38 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 6 83 3.62 4.35
1ji1A01 75.37 Neopullulanase 1Thermoactinomyces vulgaris 2.60.40.10 124 8 72 3.26 4.49
1cfbA02 75.32 Calcium ion bindingNeuron cell-cell adhesionDrosophila melanogasterNerve maturationEpidermal growth factor receptor signaling pathway 2.60.40.10 106 5 82 3.90 4.74
1qr4A01 75.22 TenascinGallus gallus 2.60.40.10 87 5 79 3.34 4.20
2rb8A00 75.08 TenascinCell adhesionSyndecan bindingECM-receptor interactionTenascin 2.60.40.10 93 3 79 3.97 5.00
Displaying entries 1 to 200 (page 1 of 2)


Domain ATOM Sequence

>pdb|2h8pB01
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKR    

Domain COMBS Sequence

>pdb|2h8pB01
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKR    

Domain History Events (85)

Domain assigned by auto on 12 Dec 2008 06:26

Assigning to "2.60.40.10" based on similarity with "1k4cB01"

Flow stage update by auto on 12 Dec 2008 06:18

No in_process hits for Domain "2h8pB01" ready to be processed

Update comment by auto on 12 Dec 2008 05:39

Domain "2h8pB01" hits Domain "2dquL01" (57.4074074074074% over 95.5752212389381%) which is currently in process

Update comment by auto on 12 Dec 2008 04:49

Domain "2h8pB01" hits Domain "2dqtL01" (57.4074074074074% over 95.5752212389381%) which is currently in process

Update comment by auto on 12 Dec 2008 03:56

Domain "2h8pB01" hits Domain "2h2pF01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 12 Dec 2008 03:01

Domain "2h8pB01" hits Domain "2h2pD01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 12 Dec 2008 01:59

Domain "2h8pB01" hits Domain "2h2sF01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 12 Dec 2008 00:36

Domain "2h8pB01" hits Domain "2h2sD01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 23:41

Domain "2h8pB01" hits Domain "2cmrL01" (60.1851851851852% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 23:13

Domain "2h8pB01" hits Domain "2gsiE01" (52.8301886792453% over 94.4444444444444%) which is currently in process

Update comment by auto on 11 Dec 2008 23:11

Domain "2h8pB01" hits Domain "2gsiG01" (52.8301886792453% over 94.4444444444444%) which is currently in process

Update comment by auto on 11 Dec 2008 23:06

Domain "2h8pB01" hits Domain "2gsiA01" (52.8301886792453% over 94.4444444444444%) which is currently in process

Update comment by auto on 11 Dec 2008 22:52

Domain "2h8pB01" hits Domain "2gsiC01" (52.8301886792453% over 94.4444444444444%) which is currently in process

Update comment by auto on 11 Dec 2008 22:37

Domain "2h8pB01" hits Domain "2gk0L01" (58.3333333333333% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 22:15

Domain "2h8pB01" hits Domain "2gk0A01" (58.3333333333333% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 22:03

Domain "2h8pB01" hits Domain "2gjzA01" (58.3333333333333% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 21:54

Domain "2h8pB01" hits Domain "2gjzL01" (58.3333333333333% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 21:51

Domain "2h8pB01" hits Domain "2ghwB02" (60.3960396039604% over 92.5925925925926%) which is currently in process

Update comment by auto on 11 Dec 2008 21:43

Domain "2h8pB01" hits Domain "2gcyA01" (67.5925925925926% over 96.4285714285714%) which is currently in process

Update comment by auto on 11 Dec 2008 21:22

Domain "2h8pB01" hits Domain "2g75D01" (37.962962962963% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 20:55

Domain "2h8pB01" hits Domain "2g60L01" (57.4074074074074% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 20:26

Domain "2h8pB01" hits Domain "2g5bE01" (58.3333333333333% over 94.6902654867257%) which is currently in process

Update comment by auto on 11 Dec 2008 19:52

Domain "2h8pB01" hits Domain "2g5bA01" (58.3333333333333% over 94.6902654867257%) which is currently in process

Update comment by auto on 11 Dec 2008 19:21

Domain "2h8pB01" hits Domain "2g5bC01" (58.3333333333333% over 94.6902654867257%) which is currently in process

Update comment by auto on 11 Dec 2008 18:48

Domain "2h8pB01" hits Domain "2g5bG01" (58.3333333333333% over 94.6902654867257%) which is currently in process

Update comment by auto on 11 Dec 2008 18:16

Domain "2h8pB01" hits Domain "2g2rA01" (55.5555555555556% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 17:46

Domain "2h8pB01" hits Domain "2g2rL01" (55.5555555555556% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 17:14

Domain "2h8pB01" hits Domain "2fx9M01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 16:46

Domain "2h8pB01" hits Domain "2fx8L01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 16:14

Domain "2h8pB01" hits Domain "2fx8M01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 15:44

Domain "2h8pB01" hits Domain "2fx8O01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 15:13

Domain "2h8pB01" hits Domain "2fx8N01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 14:45

Domain "2h8pB01" hits Domain "2fx9L01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 14:15

Domain "2h8pB01" hits Domain "2fx7L01" (61.1111111111111% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 13:47

Domain "2h8pB01" hits Domain "2ddqL01" (58.3333333333333% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 13:19

Domain "2h8pB01" hits Domain "2fr4L01" (54.6296296296296% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 12:48

Domain "2h8pB01" hits Domain "2fr4A01" (54.6296296296296% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 12:17

Domain "2h8pB01" hits Domain "2fatL01" (58.4905660377358% over 98.1481481481482%) which is currently in process

Update comment by auto on 11 Dec 2008 11:50

Domain "2h8pB01" hits Domain "2bdnL01" (56.4814814814815% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 11:24

Domain "2h8pB01" hits Domain "2b2xM01" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 11:10

Domain "2h8pB01" hits Domain "2b2xL01" (56.0747663551402% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 11:08

Domain "2h8pB01" hits Domain "2b1hL01" (37.037037037037% over 94.6428571428571%) which is currently in process

Update comment by auto on 11 Dec 2008 11:05

Domain "2h8pB01" hits Domain "2b1aL01" (37.037037037037% over 94.6428571428571%) which is currently in process

Update comment by auto on 11 Dec 2008 11:02

Domain "2h8pB01" hits Domain "2b0sL01" (37.037037037037% over 94.6428571428571%) which is currently in process

Update comment by auto on 11 Dec 2008 10:59

Domain "2h8pB01" hits Domain "2arjA01" (57.4074074074074% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 10:51

Domain "2h8pB01" hits Domain "2arjL01" (57.4074074074074% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 10:49

Domain "2h8pB01" hits Domain "2aj3A01" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 10:46

Domain "2h8pB01" hits Domain "2aj3E01" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 10:37

Domain "2h8pB01" hits Domain "2aj3C01" (57.0093457943925% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 10:26

Domain "2h8pB01" hits Domain "2agjL01" (62.037037037037% over 99.0825688073395%) which is currently in process

Update comment by auto on 11 Dec 2008 10:11

Domain "2h8pB01" hits Domain "2aepL01" (61.1111111111111% over 76.5957446808511%) which is currently in process

Update comment by auto on 11 Dec 2008 10:01

Domain "2h8pB01" hits Domain "1bbjA01" (57.4074074074074% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 09:46

Domain "2h8pB01" hits Domain "3c09L01" (58.8785046728972% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 09:25

Domain "2h8pB01" hits Domain "3c09B01" (58.8785046728972% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 08:53

Domain "2h8pB01" hits Domain "3bkmL01" (59.2592592592593% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 08:31

Domain "2h8pB01" hits Domain "3bkyL01" (58.8785046728972% over 99.0740740740741%) which is currently in process

Update comment by auto on 11 Dec 2008 08:11

Domain "2h8pB01" hits Domain "3bkjL01" (59.2592592592593% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 07:59

Domain "2h8pB01" hits Domain "3baeL01" (59.2592592592593% over 95.5752212389381%) which is currently in process

Update comment by auto on 11 Dec 2008 07:43

Domain "2h8pB01" hits Domain "3b2uL01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 07:15

Domain "2h8pB01" hits Domain "3b2uO01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 06:15

Domain "2h8pB01" hits Domain "3b2uK01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 05:15

Domain "2h8pB01" hits Domain "3b2uD01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 04:10

Domain "2h8pB01" hits Domain "3b2uR01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 02:49

Domain "2h8pB01" hits Domain "3b2uU01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 01:35

Domain "2h8pB01" hits Domain "3b2vL01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 00:22

Domain "2h8pB01" hits Domain "3b2uX01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 23:45

Domain "2h8pB01" hits Domain "3b2uG01" (62.962962962963% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 23:21

Domain "2h8pB01" hits Domain "2r9hF01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 10 Dec 2008 23:04

Domain "2h8pB01" hits Domain "2r9hD01" (57.9439252336449% over 99.0740740740741%) which is currently in process

Update comment by auto on 10 Dec 2008 22:50

Domain "2h8pB01" hits Domain "2r69L01" (63.8888888888889% over 96.4285714285714%) which is currently in process

Update comment by auto on 10 Dec 2008 22:37

Domain "2h8pB01" hits Domain "2r4sL01" (50% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 22:18

Domain "2h8pB01" hits Domain "2r4rL01" (50% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 22:05

Domain "2h8pB01" hits Domain "2r29L01" (63.8888888888889% over 96.4285714285714%) which is currently in process

Update comment by auto on 10 Dec 2008 21:53

Domain "2h8pB01" hits Domain "2qscL01" (50.9259259259259% over 99.0740740740741%) which is currently in process

Update comment by auto on 10 Dec 2008 21:48

Domain "2h8pB01" hits Domain "2qqlL01" (60.1851851851852% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 21:34

Domain "2h8pB01" hits Domain "2qqnL01" (59.8130841121495% over 99.0740740740741%) which is currently in process

Update comment by auto on 10 Dec 2008 21:15

Domain "2h8pB01" hits Domain "2qqkL01" (60.1851851851852% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 20:48

Domain "2h8pB01" hits Domain "2dtgD01" (55.1401869158879% over 99.0740740740741%) which is currently in process

Update comment by auto on 10 Dec 2008 20:30

Domain "2h8pB01" hits Domain "2nr6E01" (58.3333333333333% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 14:32

Domain "2h8pB01" hits Domain "2dtgB01" (60.1851851851852% over 94.6902654867257%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:18

Domain "2h8pB01" hits Domain "2dtgB01" (60.1851851851852% over 94.6902654867257%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2h8pB01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2h8pB01"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2h8pB01"

Insertion by auto on 05 Dec 2008 21:58

Final ChopClose added based on similarity with "1k4cB"