CATH Domain: 2h88B01 XML data for domain: 2h88B01

Molscript image for 2h88B01
2h88B01
PDB coordinates for domain 2h88B01

PDB 2h88, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.20 Ubiquitin-like (UB roll)
3.10.20.30 Gene3D
3.10.20.30.13
3.10.20.30.13.1
3.10.20.30.13.1.1
3.10.20.30.13.1.1.1
3.10.20.30.13.1.1.1.1

[top]
Segment boundaries for domain 2h88B01

Chopping figure for domain 2h88B01
DomainStart PDB ResidueStop PDB Residue
2h88B01 8 114
2h88B02 115 246

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.10.20.30.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2bs2B01 92.08 Benzoate degradation via CoA ligationButanoate metabolismOxidative phosphorylationTwo-component systemCitrate cycle (TCA cycle) 3.10.20.30 106 31 99 1.93 1.95
3etrA01 77.80 Bos taurusXanthine dehydrogenase/oxidase 3.10.20.30 85 14 70 2.84 4.05
1l5pA00 76.87 FerredoxinTrichomonas vaginalis 3.10.20.30 93 7 66 2.38 3.59
1c1yB00 75.04 RAF proto-oncogene serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayProtein binding 3.10.20.90 77 10 62 3.07 4.90
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2h88B01
TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTK
KIDPDLSKTTKIYPLPHMYVVKDLVPD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2h88B01
AQTAAAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGG
NTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPD
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 21 Aug 2007 22:29

Assigning to "3.10.20.30" based on similarity with "2h89B01"

Flow stage update by auto on 21 Aug 2007 22:29

No in_process hits for Domain "2h88B01" ready to be processed

Update comment by auto on 21 Aug 2007 22:27

Domain "2h88B01" hits Domain "2h88O01" (100% over 100%) which is currently in process

Update comment by auto on 21 Aug 2007 22:19

Domain "2h88B01" hits Domain "2fbwB01" (100% over 100%) which is currently in process

Update comment by auto on 21 Aug 2007 17:55

Domain "2h88B01" hits Domain "2h89B01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Aug 2007 17:49

Domain "2h88B01" hits Domain "2h89B01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Aug 2007 17:49

NW result present for Domain "2h88B01"

Flow stage update by auto on 16 Aug 2007 17:16

All required files are present for Domain "2h88B01"

Flow stage update by auto on 16 Aug 2007 00:03

Beginning processing for Domain "2h88B01"

Insertion by auto on 15 Aug 2007 20:09

Final ChopClose added based on similarity with "1yq3B"