CATH Domain: 2h6fA00 XML data for domain: 2h6fA00

Molscript image for 2h6fA00
2h6fA00
PDB coordinates for domain 2h6fA00

PDB 2h6f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.120 Gene3D
1.25.40.120.1
1.25.40.120.1.1
1.25.40.120.1.1.1
1.25.40.120.1.1.1.1
1.25.40.120.1.1.1.1.1

Segment boundaries for domain 2h6fA00

Chopping figure for domain 2h6fA00
DomainStart PDB ResidueStop PDB Residue
2h6fA00 55 369

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2h6fA00
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVW
HFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFK
LWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPN
LLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST    

Domain COMBS Sequence

>pdb|2h6fA00
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVW
HFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFK
LWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPN
LLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSP
TNVQQEEF    

Domain History Events (14)

Domain assigned by auto on 02 Nov 2006 06:28

Assigning to "1.25.40.120" based on similarity with "2h6gA00"

Flow stage update by auto on 02 Nov 2006 06:13

No in_process hits for Domain "2h6fA00" ready to be processed

Update comment by auto on 02 Nov 2006 03:17

Domain "2h6fA00" hits Domain "2h6gA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:57

Domain "2h6fA00" hits Domain "2h6iA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:05

Domain "2h6fA00" hits Domain "2h6hA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:29

Domain "2h6fA00" hits Domain "2bedA00" (96.1661341853035% over 95.1219512195122%) which is currently in process

Update comment by auto on 01 Nov 2006 09:49

Domain "2h6fA00" hits Domain "2bedA00" (96.1661341853035% over 95.1219512195122%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2h6fA00" hits Domain "2bedA00" (96.1661341853035% over 95.1219512195122%) which is currently in process

Update comment by auto on 01 Nov 2006 02:10

Domain "2h6fA00" hits Domain "2bedA00" (96.1661341853035% over 95.1219512195122%) which is currently in process

Flow stage update by auto on 23 Oct 2006 13:25

Domain "2h6fA00" hits Domain "2bedA00" (96.1661341853035% over 95.1219512195122%) which is currently in process

Flow stage update by auto on 23 Oct 2006 13:25

NW result present for Domain "2h6fA00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2h6fA00"

Flow stage update by auto on 16 Oct 2006 08:42

Beginning processing for Domain "2h6fA00"

Insertion by auto on 16 Oct 2006 08:34

Final ChopClose added based on similarity with "1jcqA"