CATH Domain: 2h5xB02 XML data for domain: 2h5xB02

Molscript image for 2h5xB02
2h5xB02
PDB coordinates for domain 2h5xB02

PDB 2h5x, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.18
1.10.150.20.18.1
1.10.150.20.18.1.1
1.10.150.20.18.1.1.1
1.10.150.20.18.1.1.1.3

[top]
Segment boundaries for domain 2h5xB02

Chopping figure for domain 2h5xB02
DomainStart PDB ResidueStop PDB Residue
2h5xB01 1 64
2h5xB02 65 134
2h5xB03 146 194

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 1.10.150.20.18.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bvsA02 93.60 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.150.20 70 82 95 1.10 1.15
1szpA01 84.17 DNA repair protein RAD51Identical protein bindingDouble-strand break repair via homologous recombinationHeteroduplex formationDNA-dependent ATPase activity 1.10.150.20 72 14 86 2.82 3.27
1wcnA01 82.28 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 18 82 2.91 3.53
1x66A01 82.20 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 10 88 3.56 4.02
1z1vA00 82.12 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 10 94 3.07 3.26
1dgsA05 81.77 DNA ligaseThermus filiformis 1.10.150.20 69 10 94 3.25 3.45
1go3F01 80.97 Pyrimidine metabolismPurine metabolismMethanocaldococcus jannaschiiDNA-directed RNA polymerase subunit F [EC:2.7.7.6]Uncharacterized protein MJ0039 1.10.150.80 60 15 82 3.14 3.81
1dxsA00 80.10 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 12 83 2.77 3.30
2dflA01 79.14 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 60 18 85 2.96 3.47
1kftA00 77.77 Nucleotide excision repairEscherichia coli O157:H7Excinuclease ABC subunit CUvrABC system protein C 1.10.150.20 56 26 79 3.52 4.43
1v38A00 77.34 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 8 82 3.44 4.19
1x9xA00 77.32 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 4 86 3.30 3.80
2ah5A02 77.23 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 10 80 3.53 4.36
3h8mA00 77.09 EphA7 [EC:2.7.10.1]Homo sapiensEphrin type-A receptor 7Axon guidance 1.10.150.50 71 7 88 3.96 4.46
1pk3A00 76.80 PRC1 complexIdentical protein bindingNegative regulation of transcriptionPolycomb protein ScmAxonogenesis 1.10.150.50 76 10 77 2.98 3.84
3e58A02 76.45 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 1.10.150.240 62 4 70 3.09 4.38
2q0zX02 76.26 ATP-dependent helicase activityPre-mRNA-splicing helicase BRR2 [EC:3.6.1.-]Protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseU5 snRNP 1.10.150.20 56 5 76 3.67 4.80
2hdoA02 75.75 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 1.10.150.240 59 5 69 3.23 4.67
1oxjA01 75.46 Cytoplasmic mRNA processing bodyNuclear-transcribed mRNA poly(A) tail shorteningEstablishment of RNA localizationProtein SmaugDrosophila melanogaster 1.10.150.50 61 8 86 3.57 4.11
1kl9A02 74.88 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 1.10.150.190 92 10 67 2.51 3.72
2a19A02 74.72 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 complexEukaryotic translation initiation factor 2 subunit alphaSaccharomyces cerevisiae 1.10.150.190 85 5 74 3.03 4.09
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2h5xB02
GETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2h5xB02
GETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 07 Dec 2006 21:19

Assigning to "1.10.150.20" based on similarity with "2h5xA02"

Flow stage update by auto on 07 Dec 2006 21:19

No in_process hits for Domain "2h5xB02" ready to be processed

Update comment by auto on 07 Dec 2006 17:20

Domain "2h5xB02" hits Domain "2h5xC02" (100% over 98.5714285714286%) which is currently in process

Update comment by auto on 07 Dec 2006 13:18

Domain "2h5xB02" hits Domain "2h5xD02" (100% over 97.1428571428571%) which is currently in process

Update comment by auto on 07 Dec 2006 09:21

Domain "2h5xB02" hits Domain "2h5xA02" (100% over 98.5714285714286%) which is currently in process

Flow stage update by auto on 07 Dec 2006 09:19

Domain "2h5xB02" hits Domain "2h5xA02" (100% over 98.5714285714286%) which is currently in process

Flow stage update by auto on 07 Dec 2006 09:19

NW result present for Domain "2h5xB02"

Flow stage update by auto on 06 Dec 2006 17:23

All required files are present for Domain "2h5xB02"

Flow stage update by auto on 05 Dec 2006 17:30

Beginning processing for Domain "2h5xB02"

Insertion by cuff on 05 Dec 2006 15:21

nice batch of choppings