Flow stage update by auto on 28 Nov 2006 21:32
No in_process hits for Domain "2h4pA02" ready to be processed
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2h4pA01 | -4 | 200 |
| 2h4pA01 | 303 | 369 |
| 2h4pA02 | 201 | 302 |
There are 8 matching structural neighberhood comparisons for CATH ID 2.30.39.10.10.1.1.1.1 (SIMAX score < 5)
>pdb|2h4pA02 VKFQAEKTSIQPFRLSKNKSKPVKMMYMRDTFPVLIMEKMNFKMIELPYVKRELSMFILLPDDIKDGTTGLEQLERELTY ERLSEWADSKMMTETLVDLHLP
No in_process hits for Domain "2h4pA02" ready to be processed
NW result present for Domain "2h4pA02"
All required files are present for Domain "2h4pA02"
Beginning processing for Domain "2h4pA02"
batch of easy choppings