CATH Domain: 2h2tB01 XML data for domain: 2h2tB01

Molscript image for 2h2tB01
2h2tB01
PDB coordinates for domain 2h2tB01

PDB 2h2t, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.100 Mannose-Binding Protein A; Chain A
3.10.100.10 Mannose-Binding Protein A, subunit A Gene3D
3.10.100.10.9
3.10.100.10.9.1
3.10.100.10.9.1.1
3.10.100.10.9.1.1.1
3.10.100.10.9.1.1.1.1

[top]
Segment boundaries for domain 2h2tB01

Chopping figure for domain 2h2tB01
DomainStart PDB ResidueStop PDB Residue
2h2tB01 166 286

Structural Neighbourhood (19 entries)

There are 19 matching structural neighberhood comparisons for CATH ID 3.10.100.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 19 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1kza100 90.85 Rattus norvegicusMannose bindingProtein self-associationMannose-binding lectinMannose-binding protein C 3.10.100.10 115 23 94 1.39 1.47
1h8uB00 90.21 Bone marrow proteoglycanHomo sapiensBone marrow proteoglycanExtracellular regionSugar binding 3.10.100.10 116 27 91 1.61 1.76
1g1tA01 89.26 Response to tumor necrosis factorCoated pitHeterophilic cell-cell adhesionPerinuclear region of cytoplasmPhospholipase binding 3.10.100.10 119 28 87 1.32 1.51
1jznA00 89.08 Galactose-specific lectinCrotalus atrox 3.10.100.10 135 27 85 1.46 1.71
1wmzA00 88.63 Cucumaria echinataLectin CEL-I, N-acetyl-D-galactosamine-specific C-type 3.10.100.10 140 32 82 1.46 1.78
1byfA00 88.46 LectinPolyandrocarpa misakiensis 3.10.100.10 123 20 88 1.69 1.91
1hq8A00 88.09 Positive regulation of interferon-gamma productionPositive regulation of natural killer cell mediated cytotoxicityPositive regulation of nitric oxide biosynthetic processMHC class I protein bindingNatural killer cell activation 3.10.100.10 123 26 89 1.88 2.10
1tn3A00 87.55 Skeletal system developmentHomo sapiensTetranectinProtein binding 3.10.100.10 135 24 85 1.58 1.85
3bdwA00 87.42 Killer cell lectin-like receptor subfamily D, member 1Natural killer cell mediated cytotoxicityNatural killer cells antigen CD94Antigen processing and presentationGraft-versus-host disease 3.10.100.10 123 22 91 2.74 2.98
3g8kA00 87.15 Mus musculusPlasma membraneLectin-related NK cell receptor LY49L1 3.10.100.10 127 21 88 2.31 2.60
1pwbC00 85.73 Negative regulation of T cell proliferationProtein bindingInnate immune responseLung alveolus developmentEndocytic vesicle 3.10.100.10 150 29 75 1.70 2.26
1rtm100 85.51 Calcium ion bindingMannose bindingRattus norvegicusProtein homodimerization activityExtracellular space 3.10.100.10 149 24 76 1.80 2.35
1sl6A00 85.06 Integral to plasma membraneCell-cell recognitionVirion attachment to host cell surface receptorVirion bindingHomo sapiens 3.10.100.10 168 38 67 1.54 2.27
1rjhA00 84.57 Skeletal system developmentHomo sapiensTetranectinProtein binding 3.10.100.10 118 21 85 2.23 2.61
1eslA00 83.96 Response to tumor necrosis factorCoated pitHeterophilic cell-cell adhesionPerinuclear region of cytoplasmPhospholipase binding 3.10.100.10 157 29 67 1.36 2.01
3fd4A00 80.65 Glycoprotein 42Human herpesvirus 4 (strain B95-8) 3.10.100.10 140 14 78 2.69 3.42
1cwvA05 78.06 InvasinYersinia pseudotuberculosis 3.10.100.10 100 9 70 2.63 3.72
1f00I03 78.04 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 3.10.100.10 98 13 71 3.56 4.98
2pf5D00 77.41 Cell-cell signalingHyaluronic acid bindingHomo sapiensTumor necrosis factor-inducible gene 6 proteinSignal transduction 3.10.100.10 91 7 61 2.65 4.33
[1]
Displaying entries 1 to 19 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2h2tB01
KWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKRASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNW
APGEPTSDCVMMRGSGRWNDAFCDRKLGAWVCDRLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2h2tB01
KWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKRASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNW
APGEPTSRSQSEDCVMMRGSGRWNDAFCDRKLGAWVCDRLA
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 08 Sep 2007 02:23

Assigning to "3.10.100.10" based on similarity with "2h2rA01"

Flow stage update by auto on 08 Sep 2007 02:23

No in_process hits for Domain "2h2tB01" ready to be processed

Update comment by auto on 08 Sep 2007 02:15

Domain "2h2tB01" hits Domain "2h2rA01" (100% over 100%) which is currently in process

Update comment by auto on 07 Sep 2007 22:09

Domain "2h2tB01" hits Domain "2ox9B00" (37.1900826446281% over 86.4285714285714%) which is currently in process

Update comment by auto on 07 Sep 2007 18:11

Domain "2h2tB01" hits Domain "2h2rB01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Sep 2007 18:04

Domain "2h2tB01" hits Domain "2h2rB01" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Sep 2007 18:04

NW result present for Domain "2h2tB01"

Flow stage update by auto on 06 Sep 2007 10:04

All required files are present for Domain "2h2tB01"

Flow stage update by auto on 05 Sep 2007 18:38

Beginning processing for Domain "2h2tB01"

Insertion by auto on 05 Sep 2007 18:15

Final ChopClose added based on similarity with "2h2rB"