CATH Domain: 2h1vA02 XML data for domain: 2h1vA02

Molscript image for 2h1vA02
2h1vA02
PDB coordinates for domain 2h1vA02

PDB 2h1v, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1400 Gene3D
3.40.50.1400.2
3.40.50.1400.2.1
3.40.50.1400.2.1.1
3.40.50.1400.2.1.1.1
3.40.50.1400.2.1.1.1.1

[top]
Segment boundaries for domain 2h1vA02

Chopping figure for domain 2h1vA02
DomainStart PDB ResidueStop PDB Residue
2h1vA01 2 147
2h1vA01 290 310
2h1vA02 148 289

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.50.1400.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3hcnA02 88.29 Generation of precursor metabolites and energyProtein bindingProtoporphyrinogen IX metabolic processMetabolic pathwaysPorphyrin and chlorophyll metabolism 3.40.50.1400 143 25 96 2.52 2.61
1qgoA02 80.24 Porphyrin and chlorophyll metabolismMetabolic pathwaysSirohydrochlorin cobaltochelataseSalmonella enterica subsp. enterica serovar TyphimuriumSirohydrochlorin cobaltochelatase [EC:4.99.1.3] 3.40.50.1400 134 8 74 2.96 3.97
1tjnA00 79.96 Sirohydrochlorin cobaltochelatasePorphyrin and chlorophyll metabolismArchaeoglobus fulgidusSirohydrochlorin cobaltochelatase [EC:4.99.1.3]Metabolic pathways 3.40.50.1400 125 13 69 2.97 4.26
3ckmA02 77.18 Haemophilus influenzaeUncharacterized protein HI_1655 3.40.50.2300 135 3 61 2.77 4.47
2fepA02 76.15 Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator 3.40.50.2300 140 4 68 3.25 4.76
2pjuA02 73.74 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.10660 88 10 58 2.78 4.76
1dbqA01 71.83 LacI family transcriptional regulator, purine nucleotide synthesis repressorHTH-type transcriptional repressor purREscherichia coli K-12 3.40.50.2300 134 4 54 2.72 4.95
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2h1vA02
YDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTP
DPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2h1vA02
YDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTP
DPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEM
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:42

Assigning to "3.40.50.1400" based on similarity with "1ak1002"

Flow stage update by auto on 15 Aug 2007 00:06

No in_process hits for Domain "2h1vA02" ready to be processed

Update comment by auto on 14 Aug 2007 22:50

Domain "2h1vA02" hits Domain "2c8jA02" (73.943661971831% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:15

Domain "2h1vA02" hits Domain "2h1wA02" (99.2957746478873% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:07

NW result present for Domain "2h1vA02"

Flow stage update by auto on 14 Mar 2007 15:05

All required files are present for Domain "2h1vA02"

Flow stage update by auto on 14 Mar 2007 15:01

Beginning processing for Domain "2h1vA02"

Insertion by auto on 17 Jan 2007 19:30

Final ChopClose added based on similarity with "1ak10"