CATH Domain: 2gyqA00 XML data for domain: 2gyqA00

Molscript image for 2gyqA00
2gyqA00
PDB coordinates for domain 2gyqA00

PDB 2gyq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.2
1.20.1260.10.2.1
1.20.1260.10.2.1.1
1.20.1260.10.2.1.1.1
1.20.1260.10.2.1.1.1.1

Segment boundaries for domain 2gyqA00

Chopping figure for domain 2gyqA00
DomainStart PDB ResidueStop PDB Residue
2gyqA00 1 169

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jigA00 87.83 Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1 1.20.1260.10 146 11 85 2.47 2.90
2cf7A00 86.90 Streptococcus suisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 156 9 89 4.21 4.72
1lkoA01 86.71 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 14 87 4.20 4.83
2qqyA00 86.24 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 81 2.64 3.23
2ib0A01 86.08 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 13 83 3.12 3.72
1nfvA00 85.07 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 11 79 3.93 4.92
3bt5A00 84.53 Deinococcus radioduransPutative uncharacterized protein 1.20.1260.10 148 10 90 3.96 4.39
2yw6B00 82.22 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 8 87 3.57 4.07
2qf9A01 82.06 Putative secreted proteinStreptomyces coelicolor 1.20.1260.10 140 6 85 4.13 4.86
2rklB00 70.46 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 10 31 1.35 4.24
2f93B00 69.02 Sensory rhodopsin II transducerNatronomonas pharaonisProtein binding 1.10.287.470 51 9 29 1.47 4.92
Displaying entries 1 to 11 (page 1 of 1)


Domain ATOM Sequence

>pdb|2gyqA00
MGFFSRDIQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCP
AIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVALR
AS    

Domain COMBS Sequence

>pdb|2gyqA00
GHMGFFSRDIQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
CPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVA
LRKGVNRKAASGS    

Domain History Events (12)

Domain assigned by auto on 07 Feb 2008 17:14

Assigning to "1.20.1260.10" based on similarity with "2gyqB00"

Flow stage update by auto on 07 Feb 2008 17:04

No in_process hits for Domain "2gyqA00" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:42

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:25

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Update comment by auto on 13 Jul 2007 18:45

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

Domain "2gyqA00" hits Domain "2gyqB00" (100% over 100%) which is currently in process

Flow stage update by auto on 13 Jul 2007 18:43

NW result present for Domain "2gyqA00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "2gyqA00"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "2gyqA00"

Insertion by auto on 06 Jul 2007 14:02

Final ChopClose added based on similarity with "2gyqB"