Domain assigned by cuff on 10 Apr 2008 12:51
same superfamily
CATH Domain: 2gwgA00
2gwgA00
PDB 2gwg, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.20
| Alpha-Beta Barrel | |
 3.20.20
| TIM Barrel | |
 3.20.20.140
| Metal-dependent hydrolases | Gene3D |
 3.20.20.140.6
| ||
 3.20.20.140.6.1
| ||
 3.20.20.140.6.1.1
| ||
 3.20.20.140.6.1.1.1
| ||
 3.20.20.140.6.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2gwgA00 IIDIHGHYTTAPKALEDWRNRQIAGIKDPSVPKVSELKISDDELQASIIENQLKKQERGSDLTVFSPRAGDFNVSSTWAA ICNELCYRVSQLFPDNFIGAALPQSPGVDPKTCIPELEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKVELE IPAIHVSTGAHYLNADTTAFQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEKKPLLEDHVLNNIFFDTCVYHQ PGIDLLNTVIPVDNVLFASEIGAVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRLDAALKAKGKLEH
Domain COMBS Sequence
>pdb|2gwgA00 XIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVXPKVSELKISDDELQASIIENQLKKXQERGSDLTVFSPRASFXAHHIG DFNVSSTWAAICNELCYRVSQLFPDNFIGAAXLPQSPGVDPKTCIPELEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRI WYPIYEKXVELEIPAXIHVSTSCNTCFHTTGAHYLNADTTAFXQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQ EXKKPLLEDHVLNNIFFDTCVYHQPGIDLLNTVIPVDNVLFASEXIGAVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQ IYEGNARRVYPRLDAALKAKGKLEHHHHHH
Domain History Events (76)
Domain assignment manual match h by cuff on 10 Apr 2008 12:49
same superfamily in scop, nice scores
Domain assignment manual match a by tronnberg on 10 Sep 2007 09:25
SSAP: 72.83 OV: 75 SEQ: 7. Reasonable similar overal structure, however I am not sure if the linkages are similar enough to put the query in the same topology as the match. The query's function is unknown.
Homcheck review by tronnberg on 10 Sep 2007 09:25
SSAP: 72.83 OV: 75 SEQ: 7. Reasonable similar overal structure, however I am not sure if the linkages are similar enough to put the query in the same topology as the match. The query's function is unknown.
Flow stage update by tronnberg on 10 Sep 2007 09:25
SSAP: 72.83 OV: 75 SEQ: 7. Reasonable similar overal structure, however I am not sure if the linkages are similar enough to put the query in the same topology as the match. The query's function is unknown.
Homcheck allotment by tronnberg on 10 Sep 2007 09:20
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 09:20
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 04:07
Domain "2gwgA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 04:03
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gwgA00
Flow stage update by auto on 08 Sep 2007 03:51
Retrieved PRC_PFAMCATH results for job ID SID8620804556356592 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 03:50
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 42 results for 2gwgA00
Update comment by auto on 07 Sep 2007 23:24
PRC_PFAMCATH job SID8620804556356592 is not yet finished.
Flow stage update by auto on 07 Sep 2007 23:23
The entry "2gwgA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 07 Sep 2007 23:23
The entry "2gwgA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 07 Sep 2007 22:11
Retrieved SSAP results for job ID SID0788772467723672 and results inserted.
Domain scan ssap cath by auto on 07 Sep 2007 22:10
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 155 results for 2gwgA00
Update comment by auto on 05 Sep 2007 19:14
SSAP job SID0788772467723672 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:40
The entry "2gwgA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:40
The entry "2gwgA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 05:34
Retrieved PRC results for job ID SID7435150781524672 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 05:32
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 2gwgA00
Flow stage update by auto on 05 Sep 2007 03:08
The entry "2gwgA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:08
The entry "2gwgA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 14:26
Retrieved HMM(SAM) results for job ID SID5387575728027784 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 14:25
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2gwgA00
Update comment by auto on 04 Sep 2007 11:21
HMM(SAM) job SID5387575728027784 is not yet finished.
Flow stage update by auto on 04 Sep 2007 09:30
The entry "2gwgA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 09:30
The entry "2gwgA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 21:12
Retrieved "2gwgA00" CATHEDRAL results for job ID SID1557843604591696 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 21:11
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2gwgA00
Flow stage update by auto on 03 Sep 2007 13:39
The entry "2gwgA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 13:39
The entry "2gwgA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:32
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gwgA00.scanlist" for "2gwgA00"
Write scan list by auto on 03 Sep 2007 11:32
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gwgA00.scanlist" for domain "2gwgA00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:13
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:25
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:10
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:12
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:13
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:12
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:29
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:04
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:15
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:35
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:14
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:21
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:27
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:31
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:48
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:10
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:19
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:19
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:12
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:12
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 10:25
Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 06:30
Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 02:23
Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 22:18
Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 26 Aug 2007 22:12
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Aug 2007 22:05
No in_process hits for Domain "2gwgA00" ready to be processed
Flow stage update by auto on 26 Aug 2007 22:05
NW result present for Domain "2gwgA00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2gwgA00"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2gwgA00"
Insertion by cuff on 18 Aug 2007 12:35
nice chopping
