CATH Domain: 2gviA02 XML data for domain: 2gviA02

Molscript image for 2gviA02
2gviA02
PDB coordinates for domain 2gviA02

PDB 2gvi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1330 60s Ribosomal Protein L30; Chain: A;
3.30.1330.20 Gene3D
3.30.1330.20.4
3.30.1330.20.4.1
3.30.1330.20.4.1.1
3.30.1330.20.4.1.1.1
3.30.1330.20.4.1.1.1.1

[top]
Segment boundaries for domain 2gviA02

Chopping figure for domain 2gviA02
DomainStart PDB ResidueStop PDB Residue
2gviA01 2 21
2gviA01 104 146
2gviA02 22 103
2gviA02 147 161
2gviA03 168 201

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2gviA02
YPGYRAGSYALKIAGLEKEKDHRTYLLSESPEDNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVED
EEIFEYREIDGFT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gviA02
YXPXGYRAGSYALKIAGLEKEKDHRTYLLSEXSPEDXNGCFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRV
HVEDEEIFEYREIDGFT
BLAST against CATH

[top]
Domain History Events (75)

Domain assigned by cuff on 12 Feb 2008 17:34

i agree. same superfamily

Domain assignment manual match h by rupa on 07 Sep 2007 11:17

High ssap score, same fold, unknown function. Suggest score and fit is high enough for homology.

Homcheck review by rupa on 07 Sep 2007 11:17

High ssap score, same fold, unknown function. Suggest score and fit is high enough for homology.

Flow stage update by rupa on 07 Sep 2007 11:17

High ssap score, same fold, unknown function. Suggest score and fit is high enough for homology.

Homcheck allotment by rupa on 07 Sep 2007 11:15

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 07 Sep 2007 11:15

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:47

Domain "2gviA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:46

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gviA02

Flow stage update by auto on 07 Sep 2007 00:40

Retrieved PRC_PFAMCATH results for job ID SID5985844515561564 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:38

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 2gviA02

Update comment by auto on 06 Sep 2007 05:15

PRC_PFAMCATH job SID5985844515561564 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 05:11

The entry "2gviA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 05:11

The entry "2gviA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 03:42

Retrieved SSAP results for job ID SID0179415128181760 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 03:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3179 results for 2gviA02

Update comment by auto on 05 Sep 2007 19:14

SSAP job SID0179415128181760 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:40

The entry "2gviA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:40

The entry "2gviA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:31

Retrieved PRC results for job ID SID4571140974906444 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:30

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2gviA02

Flow stage update by auto on 05 Sep 2007 03:08

The entry "2gviA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 03:08

The entry "2gviA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 14:23

Retrieved HMM(SAM) results for job ID SID2772528651759755 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 14:22

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2gviA02

Update comment by auto on 04 Sep 2007 11:21

HMM(SAM) job SID2772528651759755 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 09:30

The entry "2gviA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:30

The entry "2gviA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:10

Retrieved "2gviA02" CATHEDRAL results for job ID SID2496513915498912 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:09

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 51 results for 2gviA02

Cathedral cath submit by auto on 03 Sep 2007 13:39

The entry "2gviA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:39

The entry "2gviA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:32

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gviA02.scanlist" for "2gviA02"

Write scan list by auto on 03 Sep 2007 11:32

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gviA02.scanlist" for domain "2gviA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:11

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:35

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:04

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:13

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:10

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:19

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:25

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 22:12

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 22:05

No in_process hits for Domain "2gviA02" ready to be processed

Flow stage update by auto on 26 Aug 2007 22:05

NW result present for Domain "2gviA02"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2gviA02"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2gviA02"

Insertion by cuff on 20 Aug 2007 10:54

nice chopping