Domain assigned by cuff on 20 May 2008 12:24
new horseshoe fold - alpha horseshoe with some helical emblishment arounf the back
CATH Domain: 2gtqA05
2gtqA05
PDB 2gtq, Chain A, Domain 5
Segment boundaries for domain 2gtqA05
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2gtqA01 | 13 | 190 |
| 2gtqA02 | 191 | 275 |
| 2gtqA03 | 276 | 439 |
| 2gtqA04 | 440 | 540 |
| 2gtqA05 | 541 | 867 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2gtqA05 YSDDDLLLLLAHDSDAFTRWEAAQTLYRRAVAANLATLSDGVELPKHEKLLAAVEKVISDDLLDNAFKALLLGVPSEAEL WDGAENIDPLRYHQAREALLDTLAVHFLPKWHELNRQAAKQENQSYEYSPEAAGWRTLRNVCRAFVLRADPAHIETVAEK YGEAQNTHEWGILSAVNGNESDTRNRLLAQFADKFSDDALVDKYFALVGSSRRSDTLQQVRTALQHPKFSLENPNKARSL IGSFSRNVPHFHAEDGSGYRFIADKVIEIDRFNPQVAARLVQAFNLCNKLEPHRKNLVKQALQRIRAQEGLSKDVGEIVG KILD
Domain COMBS Sequence
>pdb|2gtqA05 YSDDDLLLLLAHDSDAFTRWEAAQTLYRRAVAANLATLSDGVELPKHEKLLAAVEKVISDDLLDNAFKALLLGVPSEAEL WDGAENIDPLRYHQAREALLDTLAVHFLPKWHELNRQAAKQENQSYEYSPEAAGWRTLRNVCRAFVLRADPAHIETVAEK YGEXAQNXTHEWGILSAVNGNESDTRNRLLAQFADKFSDDALVXDKYFALVGSSRRSDTLQQVRTALQHPKFSLENPNKA RSLIGSFSRNVPHFHAEDGSGYRFIADKVIEIDRFNPQVAARLVQAFNLCNKLEPHRKNLVKQALQRIRAQEGLSKDVGE IVGKILD
Domain History Events (75)
Domain assignment manual match a by tronnberg on 10 Sep 2007 09:19
SSAP: 64.23 OV: 60 SEQ: 4. Overal structure is reasonable similar. Functionally different.
Homcheck review by tronnberg on 10 Sep 2007 09:19
SSAP: 64.23 OV: 60 SEQ: 4. Overal structure is reasonable similar. Functionally different.
Flow stage update by tronnberg on 10 Sep 2007 09:19
SSAP: 64.23 OV: 60 SEQ: 4. Overal structure is reasonable similar. Functionally different.
Homcheck allotment by tronnberg on 10 Sep 2007 09:15
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Sep 2007 09:15
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 08 Sep 2007 11:28
Domain "2gtqA05" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 08 Sep 2007 11:26
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gtqA05
Flow stage update by auto on 08 Sep 2007 11:15
Retrieved PRC_PFAMCATH results for job ID SID6908139582024784 and results inserted.
Domain scan prc pfamcath by auto on 08 Sep 2007 11:14
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2gtqA05
Update comment by auto on 08 Sep 2007 07:50
PRC_PFAMCATH job SID6908139582024784 is not yet finished.
Flow stage update by auto on 08 Sep 2007 07:48
The entry "2gtqA05" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 08 Sep 2007 07:48
The entry "2gtqA05" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Sep 2007 06:27
Retrieved SSAP results for job ID SID6365497269665984 and results inserted.
Domain scan ssap cath by auto on 08 Sep 2007 06:26
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 18 results for 2gtqA05
Update comment by auto on 05 Sep 2007 19:14
SSAP job SID6365497269665984 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:40
The entry "2gtqA05" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:40
The entry "2gtqA05" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 05:29
Retrieved PRC results for job ID SID6467315262786896 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 05:29
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2gtqA05
Flow stage update by auto on 05 Sep 2007 03:08
The entry "2gtqA05" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 03:08
The entry "2gtqA05" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 14:21
Retrieved HMM(SAM) results for job ID SID3175973270731000 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 14:20
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2gtqA05
Update comment by auto on 04 Sep 2007 11:21
HMM(SAM) job SID3175973270731000 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 09:30
The entry "2gtqA05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:30
The entry "2gtqA05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 21:08
Retrieved "2gtqA05" CATHEDRAL results for job ID SID8459441919889816 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 21:07
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 109 results for 2gtqA05
Cathedral cath submit by auto on 03 Sep 2007 13:39
The entry "2gtqA05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:39
The entry "2gtqA05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:31
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gtqA05.scanlist" for "2gtqA05"
Write scan list by auto on 03 Sep 2007 11:31
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gtqA05.scanlist" for domain "2gtqA05"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:20
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:20
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:13
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:25
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:10
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:12
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:13
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:12
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:29
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:04
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:15
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:11
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:31
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:35
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:14
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:04
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:21
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:27
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:31
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:48
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:13
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:10
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:19
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:19
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:12
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:12
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 10:25
Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 06:30
Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 02:23
Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 22:18
Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 26 Aug 2007 22:12
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Aug 2007 22:05
No in_process hits for Domain "2gtqA05" ready to be processed
Flow stage update by auto on 26 Aug 2007 22:05
NW result present for Domain "2gtqA05"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2gtqA05"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2gtqA05"
Insertion by cuff on 18 Aug 2007 12:35
nice chopping
