CATH Domain: 2gsqA02 XML data for domain: 2gsqA02

Molscript image for 2gsqA02
2gsqA02
PDB coordinates for domain 2gsqA02

PDB 2gsq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.22
1.20.1050.10.22.1
1.20.1050.10.22.1.1
1.20.1050.10.22.1.1.1
1.20.1050.10.22.1.1.1.1

[top]
Segment boundaries for domain 2gsqA02

Chopping figure for domain 2gsqA02
DomainStart PDB ResidueStop PDB Residue
2gsqA01 1 78
2gsqA01 187 202
2gsqA02 79 186

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.22.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hqoA02 82.34 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 12 84 2.85 3.36
3cbuA02 81.64 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 21 78 2.95 3.78
1gwcA02 81.18 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 18 74 2.49 3.34
1aw9A02 81.01 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 14 85 2.96 3.44
1nhyA02 80.79 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 12 72 2.64 3.63
1v2aA02 80.04 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 16 75 2.55 3.40
1gnwA02 76.69 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 12 81 3.30 4.04
2c3nA02 76.20 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 19 65 3.23 4.97
1nkdA00 76.02 Regulatory protein ropEscherichia coli 1.10.287.230 59 3 49 2.18 4.44
1hx1B00 74.79 Anti-apoptosisReceptor signaling protein activityNucleusProtein bindingHomo sapiens 1.20.58.120 112 5 75 3.72 4.96
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gsqA02
KTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYV
ALEVPLKHTPELLKDCPKIVALRKRVAE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gsqA02
KTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYV
ALEVPLKHTPELLKDCPKIVALRKRVAE
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "2gsq002" to "2gsqA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:54

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"