Set cath from cathlist by auto on 05 Mar 2006 19:28
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2gsaA01 | 7 | 76 |
| 2gsaA01 | 326 | 433 |
| 2gsaA02 | 77 | 325 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.640.10.41.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1ohvA02 | 80.87 | 3.40.640.10 | 295 | 17 | 78 | 2.43 | 3.08 | |
![]() |
1xi9A02 | 79.19 | 3.40.640.10 | 242 | 14 | 86 | 4.01 | 4.62 | |
![]() |
1d2fA02 | 78.16 | 3.40.640.10 | 243 | 12 | 87 | 4.01 | 4.60 |
>pdb|2gsaA02 PEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADM FLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITL EHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAG IKTLELLRQ
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"