CATH Domain: 2grrA00 XML data for domain: 2grrA00

Molscript image for 2grrA00
2grrA00
PDB coordinates for domain 2grrA00

PDB 2grr, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.110 Ubiquitin Conjugating Enzyme
3.10.110.10 Ubiquitin Conjugating Enzyme Gene3D
3.10.110.10.2
3.10.110.10.2.1
3.10.110.10.2.1.1
3.10.110.10.2.1.1.1
3.10.110.10.2.1.1.1.1

[top]
Segment boundaries for domain 2grrA00

Chopping figure for domain 2grrA00
DomainStart PDB ResidueStop PDB Residue
2grrA00 1 157

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.10.110.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3h8kA00 90.48 Parkinson's diseaseUbiquitin mediated proteolysisUbiquitin-conjugating enzyme E2 G2 [EC:6.3.2.19]Homo sapiensProtein binding 3.10.110.10 164 36 92 1.57 1.69
2bepA00 89.63 Ubiquitin mediated proteolysisUbiquitin-conjugating enzyme E2 KBos taurusUbiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19] 3.10.110.10 156 29 95 1.68 1.76
2e2cA00 89.12 Ubiquitin-conjugating enzyme E2 CSpisula solidissima 3.10.110.10 156 34 94 3.10 3.27
1zdnA00 87.20 Free ubiquitin chain polymerizationExit from mitosisActivation of anaphase-promoting complex activityUbiquitin-conjugating enzyme E2 SUbiquitin mediated proteolysis 3.10.110.10 151 32 94 2.09 2.22
1br7003 87.03 3.10.110.10 117 39 74 1.15 1.54
1wzvA00 86.98 Parkinson's diseaseUbiquitin-conjugating enzyme E2 L6 [EC:6.3.2.19]Homo sapiensUbiquitin mediated proteolysisProtein binding 3.10.110.10 150 26 92 1.97 2.12
2a4dA00 83.11 Protein polyubiquitinationUbiquitin-conjugating enzyme E2 variantNucleusUbiquitin-conjugating enzyme E2 variant 1Ubiquitin conjugating enzyme complex 3.10.110.10 139 19 83 3.28 3.93
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2grrA00
MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPP
LFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQSPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2grrA00
GSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKF
EPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQSPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP
S
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 15 Aug 2007 02:52

Assigning to "3.10.110.10" based on similarity with "2pe6A00"

Flow stage update by auto on 15 Aug 2007 02:38

No in_process hits for Domain "2grrA00" ready to be processed

Update comment by auto on 15 Aug 2007 01:36

Domain "2grrA00" hits Domain "2gjdA00" (56.687898089172% over 97.5155279503106%) which is currently in process

Update comment by auto on 15 Aug 2007 00:06

Domain "2grrA00" hits Domain "2gjdB00" (56.687898089172% over 97.5155279503106%) which is currently in process

Update comment by auto on 14 Aug 2007 22:49

Domain "2grrA00" hits Domain "2gjdD00" (56.687898089172% over 97.5155279503106%) which is currently in process

Flow stage update by auto on 27 Jul 2007 02:24

Domain "2grrA00" hits Domain "2grpA00" (98.7577639751553% over 100%) which is currently in process

Flow stage update by auto on 27 Jul 2007 02:24

NW result present for Domain "2grrA00"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2grrA00"

Flow stage update by auto on 15 Jul 2007 11:36

Beginning processing for Domain "2grrA00"

Insertion by auto on 15 Jul 2007 10:30

Final ChopClose added based on similarity with "2grnA"