CATH Domain: 2gqwA03 XML data for domain: 2gqwA03

Molscript image for 2gqwA03
2gqwA03
PDB coordinates for domain 2gqwA03

PDB 2gqw, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.6
3.30.390.30.6.1
3.30.390.30.6.1.1
3.30.390.30.6.1.1.1
3.30.390.30.6.1.1.1.1

[top]
Segment boundaries for domain 2gqwA03

Chopping figure for domain 2gqwA03
DomainStart PDB ResidueStop PDB Residue
2gqwA01 6 110
2gqwA01 239 317
2gqwA02 114 236
2gqwA03 318 406

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.390.30.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q1rA03 90.61 Putidaredoxin reductasePseudomonas putida 3.30.390.30 95 28 91 1.54 1.68
1xhcA03 80.24 Pyrococcus furiosusNADH oxidase /nitrite reductase 3.30.390.30 48 25 53 1.46 2.71
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gqwA03
WYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPAT
DLRKLAAAV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gqwA03
WYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPAT
DLRKLAAAVAA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 27 Jul 2007 02:27

Assigning to "3.30.390.30" based on similarity with "1d7yA03"

Flow stage update by auto on 27 Jul 2007 02:24

No in_process hits for Domain "2gqwA03" ready to be processed

Flow stage update by auto on 27 Jul 2007 02:24

NW result present for Domain "2gqwA03"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2gqwA03"

Flow stage update by auto on 14 Jul 2007 21:06

Beginning processing for Domain "2gqwA03"

Insertion by auto on 14 Jul 2007 20:17

Final ChopClose added based on similarity with "1d7yA"