Domain assigned by auto on 07 Dec 2006 09:21
Assigning to "3.30.540.10" based on similarity with "2fhyA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2gq1A01 | 2 | 193 |
| 2gq1A02 | 195 | 332 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.30.540.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1lbvA01 | 80.94 | 3.30.540.10 | 138 | 12 | 68 | 2.23 | 3.26 | |
![]() |
1vdwA01 | 79.96 | 3.30.540.10 | 134 | 15 | 67 | 2.27 | 3.35 | |
![]() |
3bigA01 | 78.21 | 3.30.540.10 | 153 | 8 | 73 | 3.03 | 4.11 |
>pdb|2gq1A01 KTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKLDLFANEKLKAALKARDIVAGIASEEEDEIVVFEGCEHA KYVVLDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGNKQVAAGYVVYGSSTLVYTTGCGVHAFTYDPSLG VFCLCQER
Assigning to "3.30.540.10" based on similarity with "2fhyA01"
No in_process hits for Domain "2gq1A01" ready to be processed
NW result present for Domain "2gq1A01"
All required files are present for Domain "2gq1A01"
Beginning processing for Domain "2gq1A01"
decent batch of choppings