CATH Domain: 2gpjA02 XML data for domain: 2gpjA02

Molscript image for 2gpjA02
2gpjA02
PDB coordinates for domain 2gpjA02

PDB 2gpj, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.80 Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module Gene3D
3.40.50.80.10
3.40.50.80.10.1
3.40.50.80.10.1.1
3.40.50.80.10.1.1.1
3.40.50.80.10.1.1.1.1

[top]
Segment boundaries for domain 2gpjA02

Chopping figure for domain 2gpjA02
DomainStart PDB ResidueStop PDB Residue
2gpjA01 5 104
2gpjA02 105 248

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.50.80.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2piaA02 80.32 Burkholderia cepaciaPhthalate dioxygenase reductase 3.40.50.80 121 6 77 3.12 4.03
1lssA00 77.19 Trk system potassium uptake protein TrkATrk system potassium uptake protein trkA homologMethanocaldococcus jannaschii 3.40.50.720 132 3 73 3.20 4.37
2aefA01 77.17 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 3.40.50.720 115 7 70 2.87 4.08
2hmtA00 76.28 Trk system potassium uptake protein TrkABacillus subtilisKtr system potassium uptake protein A 3.40.50.720 139 7 73 3.47 4.74
1bykA02 72.31 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 117 8 69 3.23 4.63
3cs3A02 71.84 Sugar-binding transcriptional regulator, LacI familyLacI family transcriptional regulatorEnterococcus faecalis 3.40.50.2300 135 5 70 3.45 4.90
2qu7A02 70.90 Putative transcriptional regulatorStaphylococcus saprophyticus subsp. saprophyticus ATCC 15305 3.40.50.2300 137 5 71 3.45 4.85
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gpjA02
KLINFEADWFLLAGDTALPAISVNLAKLPNNAVGYAVIEVLSEADIQPLVHPEHVELHWVINPEADPEGRPLVERIAQLP
WLAGEPAVWIACEFNSRALRRHFKQAHALPKSHFYTSSYWKIGCNEGEHKLVKQEDEQLENG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gpjA02
KLINFEADWFLLAGDXTALPAISVNLAKLPNNAVGYAVIEVLSEADIQPLVHPEHVELHWVINPEADPEGRPLVERIAQL
PWLAGEPAVWIACEFNSXRALRRHFKQAHALPKSHFYTSSYWKIGCNEGEHKLVKQEDEQLENGASV
BLAST against CATH

[top]
Domain History Events (74)

Domain assigned by cuff on 04 Feb 2008 13:36

nice structural match. Homologues

Domain assignment manual match h by rupa on 07 Sep 2007 11:02

Very high ssap score, same fold. Unknown function.

Homcheck review by rupa on 07 Sep 2007 11:02

Very high ssap score, same fold. Unknown function.

Flow stage update by rupa on 07 Sep 2007 11:02

Very high ssap score, same fold. Unknown function.

Homcheck allotment by rupa on 07 Sep 2007 11:01

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 07 Sep 2007 11:01

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:37

Domain "2gpjA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:36

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gpjA02

Flow stage update by auto on 07 Sep 2007 00:23

Retrieved PRC_PFAMCATH results for job ID SID5750487436738892 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:22

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2gpjA02

Update comment by auto on 06 Sep 2007 08:26

PRC_PFAMCATH job SID5750487436738892 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 08:23

The entry "2gpjA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 08:23

The entry "2gpjA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 06:56

Retrieved SSAP results for job ID SID2257637069926744 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 06:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1910 results for 2gpjA02

Update comment by auto on 05 Sep 2007 19:13

SSAP job SID2257637069926744 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:39

The entry "2gpjA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:39

The entry "2gpjA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:23

Retrieved PRC results for job ID SID3819176261711136 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:22

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2gpjA02

Flow stage update by auto on 04 Sep 2007 13:43

The entry "2gpjA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Sep 2007 13:43

The entry "2gpjA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 11:18

Retrieved HMM(SAM) results for job ID SID4448059837299484 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 11:17

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2gpjA02

Flow stage update by auto on 04 Sep 2007 09:29

The entry "2gpjA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:29

The entry "2gpjA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:01

Retrieved "2gpjA02" CATHEDRAL results for job ID SID9142792468202208 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 21:00

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 449 results for 2gpjA02

Cathedral cath submit by auto on 03 Sep 2007 13:38

The entry "2gpjA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:38

The entry "2gpjA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:31

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gpjA02.scanlist" for "2gpjA02"

Write scan list by auto on 03 Sep 2007 11:30

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gpjA02.scanlist" for domain "2gpjA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:10

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:35

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:03

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:13

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:10

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:19

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:24

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 22:12

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 22:05

No in_process hits for Domain "2gpjA02" ready to be processed

Flow stage update by auto on 26 Aug 2007 22:05

NW result present for Domain "2gpjA02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2gpjA02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2gpjA02"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping