CATH Domain: 2gpjA01 XML data for domain: 2gpjA01

Molscript image for 2gpjA01
2gpjA01
PDB coordinates for domain 2gpjA01

PDB 2gpj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.30 Elongation Factor Tu (Ef-tu); domain 3
2.40.30.10 Translation factors Gene3D
2.40.30.10.18
2.40.30.10.18.1
2.40.30.10.18.1.1
2.40.30.10.18.1.1.1
2.40.30.10.18.1.1.1.1

[top]
Segment boundaries for domain 2gpjA01

Chopping figure for domain 2gpjA01
DomainStart PDB ResidueStop PDB Residue
2gpjA01 5 104
2gpjA02 105 248

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 2.40.30.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i8dA01 85.04 Riboflavin metabolismMetabolic pathwaysRiboflavin synthase activityRiboflavin synthase alpha chain [EC:2.5.1.9]Riboflavin synthase alpha chain 2.40.30.20 89 5 85 2.53 2.95
1qfjA01 84.90 Porphyrin and chlorophyll metabolismAquacobalamin reductase / NAD(P)H-flavin reductase [EC:1.16.1.3 1.5.1.29]NAD(P)H-flavin reductaseEscherichia coli K-12 2.40.30.10 91 14 86 2.54 2.93
1kzlA02 83.92 NucleusCytosolSchizosaccharomyces pombeMetabolic pathwaysRiboflavin metabolism 2.40.30.20 101 11 86 2.52 2.93
1i8dC02 82.29 Riboflavin metabolismMetabolic pathwaysRiboflavin synthase activityRiboflavin synthase alpha chain [EC:2.5.1.9]Riboflavin synthase alpha chain 2.40.30.20 88 9 78 2.66 3.39
2rc5B01 79.26 Leptospira interrogansFerredoxin--NADP reductase 2.40.30.10 140 19 67 2.48 3.69
2r6hA01 78.34 Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC:1.6.5.-]Porphyromonas gingivalisNADH:ubiquinone oxidoreductase, Na translocating, F subunit 2.40.30.10 138 16 66 3.03 4.54
2ck3D01 78.08 ATP catabolic processParkinson's diseaseOxidative phosphorylationAlzheimer's diseaseMetabolic pathways 2.40.10.170 73 8 71 3.06 4.28
2ey4C00 74.69 Pyrococcus furiosusSmall nucleolar rnp gar1-like proteinRNA-binding protein 2.40.10.230 73 4 70 3.12 4.43
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gpjA01
PAPRELEVIRSTYITPHLRITLGGAGLAGFPADQESAYIKLLFPQAGERPLRTYTIRQQRDDEIDVDFVLHDTDGPASSW
AKTAQVGELIQIGGPGLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gpjA01
GXXNKPAPRELEVIRSTYITPHXLRITLGGAGLAGFPADQESAYIKLLFPQAGERPLXRTYTIRQQRDDEIDVDFVLHDT
DGPASSWAKTAQVGELIQIGGPGLK
BLAST against CATH

[top]
Domain History Events (74)

Domain assigned by cuff on 04 Feb 2008 13:39

nice structural match. Homologues

Domain assignment manual match h by rupa on 07 Sep 2007 11:00

Very high ssap score, similar fold but unknonw function. Suggest score high enough for homology.

Homcheck review by rupa on 07 Sep 2007 11:00

Very high ssap score, similar fold but unknonw function. Suggest score high enough for homology.

Flow stage update by rupa on 07 Sep 2007 11:00

Very high ssap score, similar fold but unknonw function. Suggest score high enough for homology.

Homcheck allotment by rupa on 07 Sep 2007 10:57

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 07 Sep 2007 10:57

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:35

Domain "2gpjA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:34

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gpjA01

Flow stage update by auto on 07 Sep 2007 00:25

Retrieved PRC_PFAMCATH results for job ID SID4772293431180160 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:24

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 22 results for 2gpjA01

Update comment by auto on 06 Sep 2007 05:14

PRC_PFAMCATH job SID4772293431180160 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 05:10

The entry "2gpjA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 05:10

The entry "2gpjA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 03:22

Retrieved SSAP results for job ID SID7923924822550816 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 03:17

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2339 results for 2gpjA01

Update comment by auto on 05 Sep 2007 19:13

SSAP job SID7923924822550816 is not yet finished.

Flow stage update by auto on 05 Sep 2007 15:39

The entry "2gpjA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 15:39

The entry "2gpjA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:22

Retrieved PRC results for job ID SID1156822503085152 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:21

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2gpjA01

Prc cath submit by auto on 04 Sep 2007 13:43

The entry "2gpjA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:43

The entry "2gpjA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 11:17

Retrieved HMM(SAM) results for job ID SID5736754372820640 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 11:16

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2gpjA01

Flow stage update by auto on 04 Sep 2007 09:29

The entry "2gpjA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 09:29

The entry "2gpjA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 21:00

Retrieved "2gpjA01" CATHEDRAL results for job ID SID8395231784112192 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 20:59

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 96 results for 2gpjA01

Cathedral cath submit by auto on 03 Sep 2007 13:38

The entry "2gpjA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:38

The entry "2gpjA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:30

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gpjA01.scanlist" for "2gpjA01"

Write scan list by auto on 03 Sep 2007 11:30

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gpjA01.scanlist" for domain "2gpjA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:10

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:31

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:35

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:03

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:13

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:10

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:19

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:24

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 22:11

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 22:05

No in_process hits for Domain "2gpjA01" ready to be processed

Flow stage update by auto on 26 Aug 2007 22:05

NW result present for Domain "2gpjA01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2gpjA01"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2gpjA01"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping