CATH Domain: 2gnpA00 XML data for domain: 2gnpA00

Molscript image for 2gnpA00
2gnpA00
PDB coordinates for domain 2gnpA00

PDB 2gnp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1360 Gene3D
3.40.50.1360.5
3.40.50.1360.5.1
3.40.50.1360.5.1.1
3.40.50.1360.5.1.1.1
3.40.50.1360.5.1.1.1.1

[top]
Segment boundaries for domain 2gnpA00

Chopping figure for domain 2gnpA00
DomainStart PDB ResidueStop PDB Residue
2gnpA00 56 317

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1360.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2r5fA00 84.08 Transcriptional regulator, putativePseudomonas syringae pv. tomato 3.40.50.1360 213 23 81 3.81 4.66
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gnpA00
NFDTNFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGVLRNLIDDNKIGFSWGKSLSNLVDLIHSKSVRNVH
FYPLAGGPSHIHAKYHVNTLIYESRKFHGECTFNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKH
QWLDLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAYGDTKVSSILSVLRANLVNH
LITDKNTILKVLEEDGD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gnpA00
SNANFDTNXFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGVLRNLIDDNXKIGFSWGKSLSNLVDLIHSKS
VRNVHFYPLAGGPSHIHAKYHVNTLIYEXSRKFHGECTFXNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGD
FSNKGKHQWLDXLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAYGDTKVSSILSV
LRANLVNHLITDKNTILKVLEEDGDL
BLAST against CATH

[top]
Domain History Events (75)

Classification merge by cuff on 27 Jun 2008 16:13

COMMENT: Same fold, different superfamily

Ali - have another look. I believe their is evidence here to suggest that 2gnpA00 can be merged with 3.40.50.1360<br />
K - 2o0m & 2gnp transcriptional regulators. Ah SCOP puts them altogether and says they contain a common phosphate-binding site. So move 2gnpA00 into 3.40.50.1360 FINAL: move 2gnpA00 -> 3.40.50.1360 (not sure if there are other domains in this superfamily as it was a new one created during this round of homchecking)

Domain assigned by cuff on 20 Feb 2008 12:35

i agree - new superfamily. not enough evidence for homology

Domain assignment manual match t by tronnberg on 10 Sep 2007 09:14

SSAP: 76.73 OV: 68 SEQ: 9. Similar structure, the linkage differ at points but are overal reasonable similar. functionally different.

Homcheck review by tronnberg on 10 Sep 2007 09:14

SSAP: 76.73 OV: 68 SEQ: 9. Similar structure, the linkage differ at points but are overal reasonable similar. functionally different.

Flow stage update by tronnberg on 10 Sep 2007 09:14

SSAP: 76.73 OV: 68 SEQ: 9. Similar structure, the linkage differ at points but are overal reasonable similar. functionally different.

Homcheck allotment by tronnberg on 10 Sep 2007 09:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Sep 2007 09:11

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 17:12

Domain "2gnpA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 17:09

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gnpA00

Flow stage update by auto on 07 Sep 2007 17:02

Retrieved PRC_PFAMCATH results for job ID SID9180355148635808 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 17:01

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2gnpA00

Update comment by auto on 07 Sep 2007 11:47

PRC_PFAMCATH job SID9180355148635808 is not yet finished.

Flow stage update by auto on 07 Sep 2007 11:44

The entry "2gnpA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Sep 2007 11:44

The entry "2gnpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Sep 2007 10:17

Retrieved SSAP results for job ID SID0191692319609712 and results inserted.

Domain scan ssap cath by auto on 07 Sep 2007 10:15

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 431 results for 2gnpA00

Update comment by auto on 05 Sep 2007 19:13

SSAP job SID0191692319609712 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:38

The entry "2gnpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:38

The entry "2gnpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:18

Retrieved PRC results for job ID SID6770679709929472 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:17

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 2gnpA00

Prc cath submit by auto on 04 Sep 2007 13:42

The entry "2gnpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:42

The entry "2gnpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 11:14

Retrieved HMM(SAM) results for job ID SID7633834949432992 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 11:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2gnpA00

Sam cath submit by auto on 04 Sep 2007 09:29

The entry "2gnpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:29

The entry "2gnpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 20:56

Retrieved "2gnpA00" CATHEDRAL results for job ID SID7135517890017168 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 20:55

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 476 results for 2gnpA00

Cathedral cath submit by auto on 03 Sep 2007 13:38

The entry "2gnpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:38

The entry "2gnpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:30

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gnpA00.scanlist" for "2gnpA00"

Write scan list by auto on 03 Sep 2007 11:30

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gnpA00.scanlist" for domain "2gnpA00"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:20

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:15

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:10

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:30

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:35

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:03

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:13

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:10

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:19

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:24

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 22:11

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 22:05

No in_process hits for Domain "2gnpA00" ready to be processed

Flow stage update by auto on 26 Aug 2007 22:05

NW result present for Domain "2gnpA00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2gnpA00"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2gnpA00"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping