CATH Domain: 2gm6A02 XML data for domain: 2gm6A02

Molscript image for 2gm6A02
2gm6A02
PDB coordinates for domain 2gm6A02

PDB 2gm6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.11
2.60.120.10.11.1
2.60.120.10.11.1.1
2.60.120.10.11.1.1.1
2.60.120.10.11.1.1.1.1

[top]
Segment boundaries for domain 2gm6A02

Chopping figure for domain 2gm6A02
DomainStart PDB ResidueStop PDB Residue
2gm6A01 11 50
2gm6A02 51 193

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 2.60.120.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o4tA00 79.47 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 115 10 72 3.33 4.56
2ozjA00 78.99 Desulfitobacterium hafniense DCB-2Cyclic nucleotide-binding protein 2.60.120.10 104 13 67 2.87 4.23
2opkB01 78.70 Ralstonia eutropha JMP134Cupin 2 domain-containing proteinPutative uncharacterized protein 2.60.120.10 90 13 60 2.70 4.46
2pfwA00 78.27 Cupin 2 domain-containing proteinShewanella frigidimarina NCIMB 400Cupin 2, conserved barrel domain protein 2.60.120.10 109 11 74 3.62 4.86
1vj2A00 76.67 Thermotoga maritimaPutative uncharacterized protein 2.60.120.10 114 14 74 3.68 4.94
2q30A01 76.41 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 24 59 2.59 4.33
2pytA00 75.80 Ethanolamine utilization protein EutQSalmonella enterica subsp. enterica serovar TyphimuriumEthanolamine utilization protein eutQ 2.60.120.10 118 8 69 3.38 4.87
2i45D00 74.41 Neisseria meningitidis serogroup BPutative uncharacterized protein 2.60.120.10 96 8 64 2.84 4.37
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gm6A02
DWLPDAFAQPHPEYYQQLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGLRGAEYSQPFVLDGSGRPVLHGEPTRLE
PGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gm6A02
DWLPDAFAQPHPEYYQQXLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGXLRGAEYSQPFVLDGSGRPVLHGEPTR
LEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPY
BLAST against CATH

[top]
Domain History Events (131)

Domain assigned by cuff on 10 Oct 2008 15:32

same superfamily

Domain assignment manual match h by yan on 02 Sep 2008 17:20

nice superposition, good scores, 10% sequence identity, related function informed by pfam

Homcheck review by yan on 02 Sep 2008 17:20

nice superposition, good scores, 10% sequence identity, related function informed by pfam

Flow stage update by yan on 02 Sep 2008 17:20

nice superposition, good scores, 10% sequence identity, related function informed by pfam

Homcheck allotment by yan on 01 Sep 2008 15:28

User 'yan' has allocated a domain to themselves for HomChecking with comment : Alloting these 57 domains to yan to provide some homchecking work as agreed with Ali.

Domain scan prc pfamcath by auto on 25 Sep 2007 12:09

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 278 results for 2gm6A02

Homcheck allotment by cuff on 20 Aug 2007 16:23

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 20 Aug 2007 16:23

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 20 Aug 2007 11:52

Domain "2gm6A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 20 Aug 2007 11:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gm6A02

Flow stage update by auto on 20 Aug 2007 04:06

Retrieved PRC_PFAMCATH results for job ID SID5558674512912576 and chopping inserted.

Update comment by auto on 19 Aug 2007 19:35

PRC_PFAMCATH job SID5558674512912576 is not yet finished.

Prc pfamcath submit by auto on 19 Aug 2007 19:31

The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 19:31

The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 15:24

Giving up on PRC_PFAMCATH job SID6655148211400480 because submission time of Fri Aug 17 13:17:23 2007 is more than 172800 seconds older than current time (Sun Aug 19 15:24:55 2007).

Update comment by auto on 17 Aug 2007 13:21

PRC_PFAMCATH job SID6655148211400480 is not yet finished.

Prc pfamcath submit by auto on 17 Aug 2007 13:17

The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 13:17

The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 12:02

Retrieved SSAP results for job ID SID4045798752397000 and chopping inserted.

Domain scan ssap cath by auto on 17 Aug 2007 12:01

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 838 results for 2gm6A02

Update comment by auto on 16 Aug 2007 23:38

SSAP job SID4045798752397000 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 22:32

The entry "2gm6A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 22:32

The entry "2gm6A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:27

Giving up on SSAP job SID6079735775356544 because submission time of Tue Aug 14 08:37:53 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:27:26 2007).

Update comment by auto on 14 Aug 2007 10:09

SSAP job SID6079735775356544 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:37

The entry "2gm6A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:37

The entry "2gm6A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 03:39

Retrieved PRC results for job ID SID9837958212946856 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 03:39

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 2gm6A02

Flow stage update by auto on 13 Aug 2007 09:52

The entry "2gm6A02" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 09:52

The entry "2gm6A02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 05:30

Retrieved HMM(SAM) results for job ID SID7307514656766840 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 05:29

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2gm6A02

Update comment by auto on 12 Aug 2007 12:48

HMM(SAM) job SID7307514656766840 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 06:42

The entry "2gm6A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 06:42

The entry "2gm6A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 23:11

Retrieved "2gm6A02" CATHEDRAL results for job ID SID7644213542916672 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 23:10

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 340 results for 2gm6A02

Update comment by auto on 11 Aug 2007 05:31

"2gm6A02" CATHEDRAL job SID7644213542916672 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 03:50

The entry "2gm6A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 03:50

The entry "2gm6A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:27

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gm6A02.scanlist" for "2gm6A02"

Write scan list by auto on 11 Aug 2007 01:26

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gm6A02.scanlist" for domain "2gm6A02"

Update comment by auto on 10 Aug 2007 14:30

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:29

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:42

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:43

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:30

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:10

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:54

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:54

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:40

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:47

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:31

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:38

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:38

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:00

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:46

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:52

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:41

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:28

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:08

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:39

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:50

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:44

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:32

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:46

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:40

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:17

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:11

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:09

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 19:00

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:14

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:06

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:46

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:01

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:03

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:02

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:54

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:02

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:50

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:47

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:41

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:53

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:55

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:54

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:42

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:23

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:16

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:56

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:56

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:55

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:38

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:26

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:57

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:48

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:49

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:54

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:37

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:54

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:46

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:04

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:18

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:22

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:26

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:48

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:18

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:58

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:24

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:25

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:24

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:24

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:30

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:06

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:00

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:01

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:04

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:09

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:44

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:02

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:55

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:50

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:51

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:45

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:10

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Jul 2007 22:47

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Jul 2007 22:43

No in_process hits for Domain "2gm6A02" ready to be processed

Flow stage update by auto on 26 Jul 2007 22:43

NW result present for Domain "2gm6A02"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2gm6A02"

Flow stage update by auto on 10 Jul 2007 12:04

Beginning processing for Domain "2gm6A02"

Insertion by cuff on 10 Jul 2007 11:18

nice chopping