Domain assigned by cuff on 10 Oct 2008 15:32
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
2
| Mainly Beta | |
2.60
| Sandwich | |
2.60.120
| Jelly Rolls | |
2.60.120.10
| Jelly Rolls | Gene3D |
2.60.120.10.11
| ||
2.60.120.10.11.1
| ||
2.60.120.10.11.1.1
| ||
2.60.120.10.11.1.1.1
| ||
2.60.120.10.11.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2gm6A01 | 11 | 50 |
| 2gm6A02 | 51 | 193 |
There are 8 matching structural neighberhood comparisons for CATH ID 2.60.120.10.11.1.1.1.1 (SIMAX score < 5)
>pdb|2gm6A02 DWLPDAFAQPHPEYYQQLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGLRGAEYSQPFVLDGSGRPVLHGEPTRLE PGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPY
same superfamily
nice superposition, good scores, 10% sequence identity, related function informed by pfam
nice superposition, good scores, 10% sequence identity, related function informed by pfam
nice superposition, good scores, 10% sequence identity, related function informed by pfam
User 'yan' has allocated a domain to themselves for HomChecking with comment : Alloting these 57 domains to yan to provide some homchecking work as agreed with Ali.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 278 results for 2gm6A02
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2gm6A02" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gm6A02
Retrieved PRC_PFAMCATH results for job ID SID5558674512912576 and chopping inserted.
PRC_PFAMCATH job SID5558674512912576 is not yet finished.
The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.
Giving up on PRC_PFAMCATH job SID6655148211400480 because submission time of Fri Aug 17 13:17:23 2007 is more than 172800 seconds older than current time (Sun Aug 19 15:24:55 2007).
PRC_PFAMCATH job SID6655148211400480 is not yet finished.
The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2gm6A02" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID4045798752397000 and chopping inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 838 results for 2gm6A02
SSAP job SID4045798752397000 is not yet finished.
The entry "2gm6A02" has been submitted to the SSAP webservice.
The entry "2gm6A02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID6079735775356544 because submission time of Tue Aug 14 08:37:53 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:27:26 2007).
SSAP job SID6079735775356544 is not yet finished.
The entry "2gm6A02" has been submitted to the SSAP webservice.
The entry "2gm6A02" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID9837958212946856 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 2gm6A02
The entry "2gm6A02" has been submitted to the PRC webservice.
The entry "2gm6A02" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID7307514656766840 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2gm6A02
HMM(SAM) job SID7307514656766840 is not yet finished.
The entry "2gm6A02" has been submitted to the HMM (SAM) webservice.
The entry "2gm6A02" has been submitted to the HMM (SAM) webservice.
Retrieved "2gm6A02" CATHEDRAL results for job ID SID7644213542916672 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 340 results for 2gm6A02
"2gm6A02" CATHEDRAL job SID7644213542916672 is not yet finished.
The entry "2gm6A02" has been submitted to the CATHEDRAL webservice.
The entry "2gm6A02" has been submitted to the CATHEDRAL webservice.
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gm6A02.scanlist" for "2gm6A02"
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gm6A02.scanlist" for domain "2gm6A02"
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2gm6A02" ready to be processed
NW result present for Domain "2gm6A02"
All required files are present for Domain "2gm6A02"
Beginning processing for Domain "2gm6A02"
nice chopping