CATH Domain: 2gm5B00 XML data for domain: 2gm5B00

Molscript image for 2gm5B00
2gm5B00
PDB coordinates for domain 2gm5B00

PDB 2gm5, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1390 Gene3D
3.40.50.1390.1
3.40.50.1390.1.1
3.40.50.1390.1.1.1
3.40.50.1390.1.1.1.1
3.40.50.1390.1.1.1.1.1

Segment boundaries for domain 2gm5B00

Chopping figure for domain 2gm5B00
DomainStart PDB ResidueStop PDB Residue
2gm5B00 2 123

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1390.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rslA00 91.71 Transposon gamma-delta resolvaseEscherichia coli K-12 3.40.50.1390 114 90 94 1.38 1.46
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2gm5B00
ALFGYARVSTSLDIQVRALKDAGVKANRIFTDKADRKGLDLLRKVKEGDVILVKKLDHLGRDTADIQLIKEFDAQGVSIR
FIDDGISTDSYIGKVVTILSAVAQAERQRIL    

Domain COMBS Sequence

>pdb|2gm5B00
ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRXKVKEGDVILVKKLDHLGRDTADXIQLIK
EFDAQGVSIRFIDDGISTDSYIGKXVVTILSAVAQAERQRIL    

Domain History Events (12)

Domain assigned by auto on 01 Nov 2006 22:17

Assigning to "3.40.50.1390" based on similarity with "2rslA00"

Flow stage update by auto on 01 Nov 2006 21:57

No in_process hits for Domain "2gm5B00" ready to be processed

Update comment by auto on 01 Nov 2006 18:05

Domain "2gm5B00" hits Domain "2gm5D00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2gm5B00" hits Domain "2gm5A00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Update comment by auto on 01 Nov 2006 09:49

Domain "2gm5B00" hits Domain "2gm5A00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2gm5B00" hits Domain "2gm5A00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Update comment by auto on 01 Nov 2006 02:10

Domain "2gm5B00" hits Domain "2gm5A00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Flow stage update by auto on 22 Oct 2006 21:18

Domain "2gm5B00" hits Domain "2gm5A00" (97.5409836065574% over 87.7697841726619%) which is currently in process

Flow stage update by auto on 22 Oct 2006 21:18

NW result present for Domain "2gm5B00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2gm5B00"

Flow stage update by auto on 16 Oct 2006 03:14

Beginning processing for Domain "2gm5B00"

Insertion by auto on 15 Oct 2006 23:51

Final ChopClose added based on similarity with "2rslA"