CATH Domain: 2gjgA02

2gjgA02

PDB 2gjg, Chain A, Domain 2

CATH Code	Level Description	Links
2	Mainly Beta
2.40	Beta Barrel
2.40.10	Thrombin, subunit H
2.40.10.220	predicted glycosyltransferase like domains	Gene3D
2.40.10.220.2
2.40.10.220.2.1
2.40.10.220.2.1.1
2.40.10.220.2.1.1.1
2.40.10.220.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2gjgA02

Domain	Start PDB Residue	Stop PDB Residue
2gjgA01	11	121
2gjgA02	122	247

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|2gjgA02
RRNAFRAALKLSQLVDIILDGAHLKGNGARGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTVELRHLH
YEERINTTFAGVRFHNLSGQAQRKIESFVYQLQREARRFDKDDY

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2gjgA02
RRNAFRAALKLSQLVDIILDGAHLKGNGAXRGKLLDISATGCKLRFEGNVEDRLQLGQVYERFKAGNPLGLVDTXVELRH
LHYEERINTTFAGVRFHNLSGQAQRKIESFVYQLQREARRFDKDDY

BLAST against CATH

[top]
Domain History Events (135)

Domain assigned by cuff on 15 Apr 2008 10:48

same fold but no functional evidence means not possible to assign to a superfamily

Homcheck comment by cuff on 20 Feb 2008 19:06

not convinced regarding fold similarity

Domain assignment manual match t by cuff on 20 Feb 2008 19:00

no functional evidence for superfamily match but same fold

Domain assignment manual match a by tronnberg on 04 Sep 2007 15:52

SSAP: 73.13 OV: 77 SEQ: 6. Very low linkage similarity. I believe that 1ylnA02 (TBA) should be assign to the same topology family as the query.

Homcheck review by tronnberg on 04 Sep 2007 15:52

SSAP: 73.13 OV: 77 SEQ: 6. Very low linkage similarity. I believe that 1ylnA02 (TBA) should be assign to the same topology family as the query.

Flow stage update by tronnberg on 04 Sep 2007 15:52

SSAP: 73.13 OV: 77 SEQ: 6. Very low linkage similarity. I believe that 1ylnA02 (TBA) should be assign to the same topology family as the query.

Domain assignment manual match a by tronnberg on 20 Aug 2007 16:27

SSAP=75, low seq similarity and the linker folds is not very similar.. Unknown function for query.

Homcheck allotment by tronnberg on 20 Aug 2007 16:21

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Aug 2007 16:21

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 20 Aug 2007 11:51

Domain "2gjgA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 20 Aug 2007 11:50

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2gjgA02

Flow stage update by auto on 20 Aug 2007 04:04

Retrieved PRC_PFAMCATH results for job ID SID9605764010393408 and chopping inserted.

Domain scan prc pfamcath by auto on 20 Aug 2007 04:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2gjgA02

Update comment by auto on 19 Aug 2007 19:35

PRC_PFAMCATH job SID9605764010393408 is not yet finished.

Prc pfamcath submit by auto on 19 Aug 2007 19:31

The entry "2gjgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 19:31

The entry "2gjgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 15:24

Giving up on PRC_PFAMCATH job SID1480997400435872 because submission time of Fri Aug 17 13:17:06 2007 is more than 172800 seconds older than current time (Sun Aug 19 15:24:32 2007).

Update comment by auto on 17 Aug 2007 13:20

PRC_PFAMCATH job SID1480997400435872 is not yet finished.

Prc pfamcath submit by auto on 17 Aug 2007 13:17

The entry "2gjgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 13:17

The entry "2gjgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 11:58

Retrieved SSAP results for job ID SID1263172415956864 and chopping inserted.

Domain scan ssap cath by auto on 17 Aug 2007 11:55

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2236 results for 2gjgA02

Update comment by auto on 16 Aug 2007 23:38

SSAP job SID1263172415956864 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 22:32

The entry "2gjgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 22:32

The entry "2gjgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:27

Giving up on SSAP job SID4751053459314400 because submission time of Tue Aug 14 08:36:38 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:27:09 2007).

Update comment by auto on 14 Aug 2007 10:08

SSAP job SID4751053459314400 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:36

The entry "2gjgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:36

The entry "2gjgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 03:31

Retrieved PRC results for job ID SID8312348939718875 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 03:30

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2gjgA02

Flow stage update by auto on 13 Aug 2007 09:49

The entry "2gjgA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 09:49

The entry "2gjgA02" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 05:22

Retrieved HMM(SAM) results for job ID SID0695958989982416 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 05:21

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2gjgA02

Update comment by auto on 12 Aug 2007 12:47

HMM(SAM) job SID0695958989982416 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 06:41

The entry "2gjgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 06:41

The entry "2gjgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 23:02

Retrieved "2gjgA02" CATHEDRAL results for job ID SID4521991535601184 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 23:02

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 105 results for 2gjgA02

Update comment by auto on 11 Aug 2007 05:30

"2gjgA02" CATHEDRAL job SID4521991535601184 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 03:49

The entry "2gjgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 03:49

The entry "2gjgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:24

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gjgA02.scanlist" for "2gjgA02"

Write scan list by auto on 11 Aug 2007 01:24

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2gjgA02.scanlist" for domain "2gjgA02"

Update comment by auto on 10 Aug 2007 14:30

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:29

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:42

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:43

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:30

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:10

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:54

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:54

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:40

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:47

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:30

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:38

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:37

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:00

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:46

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:52

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:41

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:27

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:08

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:38

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:49

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:44

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:32

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:46

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:39

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:17

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:11

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:08

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 18:59

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:14

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:06

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:46

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:01

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:02

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:02

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:54

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:02

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:50

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:46

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:41

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:53

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:55

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:53

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:41

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:22

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:15

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:56

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:56

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:55

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:38

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:26

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:56

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:47

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:49

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:53

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:36

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:54

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:46

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:03

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:17

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:22

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:25

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:47

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:18

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:58

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:24

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:24

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:24

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:23

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:29

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:05

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 15:00

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 11:00

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:04

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:08

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:43

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:02

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:55

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:49

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:50

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:44

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:09

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:29

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:53

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Jul 2007 15:24

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Jul 2007 15:20

No in_process hits for Domain "2gjgA02" ready to be processed

Flow stage update by auto on 26 Jul 2007 15:20

NW result present for Domain "2gjgA02"

Flow stage update by auto on 12 Jul 2007 02:02

All required files are present for Domain "2gjgA02"

Flow stage update by auto on 10 Jul 2007 14:03

Beginning processing for Domain "2gjgA02"

Insertion by cuff on 10 Jul 2007 12:31

nice chopping

CATH Domain: 2gjgA02

PDB 2gjg, Chain A, Domain 2

[top] Segment boundaries for domain 2gjgA02

What is a Structural Neighbour?

Structural Neighbourhood (0 entries)

[top] Domain ATOM Sequence

[top] Domain COMBS Sequence

[top] Domain History Events (135)

Domain assigned by cuff on 15 Apr 2008 10:48

Homcheck comment by cuff on 20 Feb 2008 19:06

Domain assignment manual match t by cuff on 20 Feb 2008 19:00

Domain assignment manual match a by tronnberg on 04 Sep 2007 15:52

Homcheck review by tronnberg on 04 Sep 2007 15:52

Flow stage update by tronnberg on 04 Sep 2007 15:52

Domain assignment manual match a by tronnberg on 20 Aug 2007 16:27

Homcheck allotment by tronnberg on 20 Aug 2007 16:21

Flow stage update by tronnberg on 20 Aug 2007 16:21

Flow stage update by auto on 20 Aug 2007 11:51

Domain scan scop cath by auto on 20 Aug 2007 11:50

Flow stage update by auto on 20 Aug 2007 04:04

Domain scan prc pfamcath by auto on 20 Aug 2007 04:03

Update comment by auto on 19 Aug 2007 19:35

Prc pfamcath submit by auto on 19 Aug 2007 19:31

Flow stage update by auto on 19 Aug 2007 19:31

Flow stage update by auto on 19 Aug 2007 15:24

Update comment by auto on 17 Aug 2007 13:20

Prc pfamcath submit by auto on 17 Aug 2007 13:17

Flow stage update by auto on 17 Aug 2007 13:17

Flow stage update by auto on 17 Aug 2007 11:58

Domain scan ssap cath by auto on 17 Aug 2007 11:55

Update comment by auto on 16 Aug 2007 23:38

Ssap cath submit by auto on 16 Aug 2007 22:32

Flow stage update by auto on 16 Aug 2007 22:32

Flow stage update by auto on 16 Aug 2007 17:27

Update comment by auto on 14 Aug 2007 10:08

Ssap cath submit by auto on 14 Aug 2007 08:36

Flow stage update by auto on 14 Aug 2007 08:36

Flow stage update by auto on 14 Aug 2007 03:31

Domain scan prc cath by auto on 14 Aug 2007 03:30

Flow stage update by auto on 13 Aug 2007 09:49

Prc cath submit by auto on 13 Aug 2007 09:49

Flow stage update by auto on 13 Aug 2007 05:22

Domain scan sam cath by auto on 13 Aug 2007 05:21

Update comment by auto on 12 Aug 2007 12:47

Sam cath submit by auto on 12 Aug 2007 06:41

Flow stage update by auto on 12 Aug 2007 06:41

Flow stage update by auto on 11 Aug 2007 23:02

Domain scan cathedral cath by auto on 11 Aug 2007 23:02

Update comment by auto on 11 Aug 2007 05:30

Cathedral cath submit by auto on 11 Aug 2007 03:49

Flow stage update by auto on 11 Aug 2007 03:49

Flow stage update by auto on 11 Aug 2007 01:24

Write scan list by auto on 11 Aug 2007 01:24

Update comment by auto on 10 Aug 2007 14:30

Update comment by auto on 10 Aug 2007 10:29

Update comment by auto on 10 Aug 2007 06:42

Update comment by auto on 10 Aug 2007 02:43

Update comment by auto on 09 Aug 2007 22:30

Update comment by auto on 09 Aug 2007 19:10

Update comment by auto on 09 Aug 2007 14:54

Update comment by auto on 09 Aug 2007 10:54

Update comment by auto on 09 Aug 2007 06:40

Update comment by auto on 09 Aug 2007 02:47

Update comment by auto on 08 Aug 2007 22:30

Update comment by auto on 08 Aug 2007 18:38

Update comment by auto on 08 Aug 2007 14:37

Update comment by auto on 08 Aug 2007 11:00

Update comment by auto on 08 Aug 2007 06:46

Update comment by auto on 08 Aug 2007 02:52

Update comment by auto on 07 Aug 2007 22:41

Update comment by auto on 07 Aug 2007 19:27

Update comment by auto on 07 Aug 2007 15:08

Update comment by auto on 07 Aug 2007 10:38

Update comment by auto on 07 Aug 2007 06:49

Update comment by auto on 07 Aug 2007 02:44

Update comment by auto on 06 Aug 2007 22:32

Update comment by auto on 06 Aug 2007 18:46

Update comment by auto on 06 Aug 2007 14:39

Update comment by auto on 06 Aug 2007 11:17

Update comment by auto on 06 Aug 2007 09:11

[top]
Segment boundaries for domain 2gjgA02

[top]
Domain ATOM Sequence

[top]
Domain COMBS Sequence

[top]
Domain History Events (135)