CATH Domain: 2ghsA00 XML data for domain: 2ghsA00

Molscript image for 2ghsA00
2ghsA00
PDB coordinates for domain 2ghsA00

PDB 2ghs, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.120 6 Propellor
2.120.10 Neuraminidase
2.120.10.30 TolB, C-terminal domain Gene3D
2.120.10.30.3
2.120.10.30.3.1
2.120.10.30.3.1.1
2.120.10.30.3.1.1.1
2.120.10.30.3.1.1.1.1

Segment boundaries for domain 2ghsA00

Chopping figure for domain 2ghsA00
DomainStart PDB ResidueStop PDB Residue
2ghsA00 20 314

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.120.10.30.3.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p4oA01 81.44 Nostoc sp. PCC 7120All0351 protein 2.120.10.30 285 16 90 2.90 3.20
1npeA00 75.99 Mus musculusCell-matrix adhesionNidogen-1Collagen bindingBasement membrane 2.120.10.30 263 9 80 3.57 4.43
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|2ghsA00
LATVFPFAGRVLDETPLLGEGPTFDPASGTAWWFNILERELHELHLASGRKTVHALPFGSALAKISDSKQLIASDDGLFL
RDTATGVLTLHAELESDLPGNRSNDGRHPSGALWIGTGRKAETGAGSIYHVAKGKVTKLFADISIPNSICFSPDGTTGYF
VDTKVNRLRVPLDARTGLPTGKAEVFIDSTGIKGGDGSVCDAEGHIWNARWGEGAVDRYDTDGNHIARYEVPGKQTTCPA
FIGPDASRLLVTSAREHLDDDAITANPQHGLTFELGIEVKGRFEPLYRL    

Domain COMBS Sequence

>pdb|2ghsA00
LATVFPFAGRVLDETPXLLGEGPTFDPASGTAWWFNILERELHELHLASGRKTVHALPFXGSALAKISDSKQLIASDDGL
FLRDTATGVLTLHAELESDLPGNRSNDGRXHPSGALWIGTXGRKAETGAGSIYHVAKGKVTKLFADISIPNSICFSPDGT
TGYFVDTKVNRLXRVPLDARTGLPTGKAEVFIDSTGIKGGXDGSVCDAEGHIWNARWGEGAVDRYDTDGNHIARYEVPGK
QTTCPAFIGPDASRLLVTSAREHLDDDAITANPQHGLTFELGIEVKGRFEPLYRL    

Domain History Events (269)

Domain assigned by cuff on 14 Feb 2008 11:21

same superfamily

Domain assignment manual match h by cuff on 14 Feb 2008 11:20

same superfamily. SCOP agrees

Homcheck comment by cuff on 29 Oct 2007 14:35

same fold group fpr sure. almost certainly same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 12:37

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 177 results for 2ghsA00

Homcheck comment by tronnberg on 14 Sep 2007 12:06

The query's function is unknown. Very similar linkage and structure.

Domain assignment manual match t by tronnberg on 28 Aug 2007 11:52

SSAP= 82, OV= 84, Seq sim= 19. Very similar linkage.

Homcheck review by tronnberg on 28 Aug 2007 11:52

SSAP= 82, OV= 84, Seq sim= 19. Very similar linkage.

Flow stage update by tronnberg on 28 Aug 2007 11:52

SSAP= 82, OV= 84, Seq sim= 19. Very similar linkage.

Homcheck allotment by tronnberg on 28 Aug 2007 11:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 28 Aug 2007 11:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 25 Aug 2007 18:57

Domain "2ghsA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 25 Aug 2007 18:56

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2ghsA00

Flow stage update by auto on 25 Aug 2007 18:45

Retrieved PRC_PFAMCATH results for job ID SID0293451749683024 and results inserted.

Update comment by auto on 25 Aug 2007 14:49

PRC_PFAMCATH job SID0293451749683024 is not yet finished.

Prc pfamcath submit by auto on 25 Aug 2007 14:47

The entry "2ghsA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 14:47

The entry "2ghsA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Aug 2007 14:13

Retrieved SSAP results for job ID SID6273194194511616 and results inserted.

Domain scan ssap cath by auto on 25 Aug 2007 14:12

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 70 results for 2ghsA00

Update comment by auto on 23 Aug 2007 22:40

SSAP job SID6273194194511616 is not yet finished.

Ssap cath submit by auto on 23 Aug 2007 22:28

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 22:28

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Aug 2007 19:30

Giving up on SSAP job SID6386824604422720 because submission time of Tue Aug 21 17:58:21 2007 is more than 172800 seconds older than current time (Thu Aug 23 19:30:28 2007).

Update comment by auto on 21 Aug 2007 18:00

SSAP job SID6386824604422720 is not yet finished.

Ssap cath submit by auto on 21 Aug 2007 17:58

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 17:58

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Aug 2007 11:02

Giving up on SSAP job SID9986523934337152 because submission time of Sun Aug 19 07:11:07 2007 is more than 172800 seconds older than current time (Tue Aug 21 11:02:53 2007).

Update comment by auto on 19 Aug 2007 08:09

SSAP job SID9986523934337152 is not yet finished.

Ssap cath submit by auto on 19 Aug 2007 07:11

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 07:11

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 19 Aug 2007 03:14

Giving up on SSAP job SID8083313294573504 because submission time of Thu Aug 16 23:07:26 2007 is more than 172800 seconds older than current time (Sun Aug 19 03:14:44 2007).

Update comment by auto on 17 Aug 2007 00:13

SSAP job SID8083313294573504 is not yet finished.

Ssap cath submit by auto on 16 Aug 2007 23:07

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 23:07

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 18:13

Giving up on SSAP job SID2195940340167040 because submission time of Tue Aug 14 08:34:26 2007 is more than 172800 seconds older than current time (Thu Aug 16 18:13:16 2007).

Update comment by auto on 14 Aug 2007 10:07

SSAP job SID2195940340167040 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:34

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:34

The entry "2ghsA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 03:16

Retrieved PRC results for job ID SID1247217392760105 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 03:15

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 37 results for 2ghsA00

Flow stage update by auto on 13 Aug 2007 09:46

The entry "2ghsA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 09:46

The entry "2ghsA00" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 05:08

Retrieved HMM(SAM) results for job ID SID7997239578544608 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 05:07

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 11 results for 2ghsA00

Update comment by auto on 12 Aug 2007 12:45

HMM(SAM) job SID7997239578544608 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 06:38

The entry "2ghsA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 06:38

The entry "2ghsA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 22:47

Retrieved "2ghsA00" CATHEDRAL results for job ID SID6837350348485888 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 22:47

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 53 results for 2ghsA00

Update comment by auto on 11 Aug 2007 05:29

"2ghsA00" CATHEDRAL job SID6837350348485888 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 03:47

The entry "2ghsA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 03:47

The entry "2ghsA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 01:18

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2ghsA00.scanlist" for "2ghsA00"

Write scan list by auto on 11 Aug 2007 01:17

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2ghsA00.scanlist" for domain "2ghsA00"

Update comment by auto on 10 Aug 2007 14:30

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:29

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:42

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:43

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:30

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:10

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:53

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:53

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:40

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:46

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:30

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:38

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:37

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 11:00

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:46

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:51

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:40

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:27

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:08

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:38

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:49

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:44

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:32

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:45

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:39

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:17

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:11

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:08

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 18:59

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:13

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:06

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:45

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 19:00

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 15:02

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 11:01

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:53

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 03:01

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:50

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:46

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:41

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:52

Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:54

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:53

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:41

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:22

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:14

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:55

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:55

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:54

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:38

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:25

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:56

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:47

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:48

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:53

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:36

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:53

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:45

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 11:03

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:17

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:21

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:25

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:47

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:17

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:57

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:23

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:23

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:23

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:22

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:29

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 19:04

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 14:59

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 10:59

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 07:03

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 03:07

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:43

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 19:01

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:54

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:49

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:49

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:44

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 23:08

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:27

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:52

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:24

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:28

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:40

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:53

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:26

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 11:09

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 07:09

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 03:02

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:50

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:16

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:14

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 11:10

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:14

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 03:07

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 23:06

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:22

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 15:12

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:21

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:25

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:40

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:41

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:38

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:35

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:28

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:49

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:30

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:29

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:33

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:35

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:28

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:51

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:27

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 20:00

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:49

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:22

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 07:11

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 03:07

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:19

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:45

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:48

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:35

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:18

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:34

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 23:00

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:16

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:11

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:31

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:28

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:51

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 22:08

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 16:08

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 11:10

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:17

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:19

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 23:03

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:25

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:43

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 11:02

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:43

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:48

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:24

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 22:58

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:44

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:36

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 12:02

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:28

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:32

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:19

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:21

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:11

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:04

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:12

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 19:03

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 16:13

Waiting for 1013 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 14:11

Waiting for 1040 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 12:29

Waiting for 1062 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 10:04

Waiting for 1110 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 08:05

Waiting for 1159 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 06:04

Waiting for 1205 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 04:04

Waiting for 1240 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 02:10

Waiting for 1265 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 00:14

Waiting for 1270 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 22:08

Waiting for 1282 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 20:12

Waiting for 1285 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 18:10

Waiting for 1276 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 16:12

Waiting for 1258 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 14:07

Waiting for 1144 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 12:09

Waiting for 1163 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 10:06

Waiting for 1196 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 08:06

Waiting for 1231 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 06:06

Waiting for 1257 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 04:04

Waiting for 1280 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 00:07

Waiting for 1308 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 22:02

Waiting for 1315 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 20:02

Waiting for 1304 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 18:05

Waiting for 1290 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 16:05

Waiting for 1275 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 14:07

Waiting for 1248 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 12:08

Waiting for 1207 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 10:12

Waiting for 1071 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 08:12

Waiting for 1065 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 06:11

Waiting for 1055 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 04:12

Waiting for 1045 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 02:24

Waiting for 1027 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 00:36

Waiting for 1000 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 22:23

Waiting for 958 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 19:15

Waiting for 910 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 14:59

Waiting for 810 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 18:06

Waiting for 596 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 16:04

Waiting for 594 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 14:04

Waiting for 592 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 12:03

Waiting for 590 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 10:15

Waiting for 588 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 08:15

Waiting for 583 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 06:17

Waiting for 578 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 04:17

Waiting for 572 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 02:18

Waiting for 564 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 00:19

Waiting for 556 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 22:13

Waiting for 548 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 20:17

Waiting for 536 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 18:19

Waiting for 517 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 16:23

Waiting for 483 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 14:27

Waiting for 439 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 11:15

Waiting for 101 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 10:03

Waiting for 100 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 08:38

Waiting for 111 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Flow stage update by auto on 06 Jul 2007 08:37

No satisfactory AssignClose result found.

Flow stage update by auto on 06 Jul 2007 08:34

No in_process hits for Domain "2ghsA00" ready to be processed

Flow stage update by auto on 06 Jul 2007 08:34

NW result present for Domain "2ghsA00"

Flow stage update by auto on 04 Jul 2007 22:02

All required files are present for Domain "2ghsA00"

Flow stage update by auto on 04 Jul 2007 12:48

Beginning processing for Domain "2ghsA00"

Insertion by cuff on 04 Jul 2007 11:04

checked chopping