CATH Domain: 2gg2A00 XML data for domain: 2gg2A00

Molscript image for 2gg2A00
2gg2A00
PDB coordinates for domain 2gg2A00

PDB 2gg2, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.230 Creatine Amidinohydrolase
3.90.230.10 Creatinase/methionine aminopeptidase superfamily Gene3D
3.90.230.10.1
3.90.230.10.1.1
3.90.230.10.1.1.1
3.90.230.10.1.1.1.1
3.90.230.10.1.1.1.1.1

[top]
Segment boundaries for domain 2gg2A00

Chopping figure for domain 2gg2A00
DomainStart PDB ResidueStop PDB Residue
2gg2A00 2 264

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.230.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qxyA00 88.71 Methionyl aminopeptidase [EC:3.4.11.18]Staphylococcus aureus subsp. aureus Mu50Methionine aminopeptidase 3.90.230.10 249 32 93 1.58 1.69
1xgsA01 86.63 Pyrococcus furiosusMethionyl aminopeptidase [EC:3.4.11.18]Methionine aminopeptidase 3.90.230.10 218 30 81 1.59 1.95
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gg2A00
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI
PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG
FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT
DNGCEILTLRKDDTIPAIISHDE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gg2A00
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI
PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG
FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT
DNGCEILTLRKDDTIPAIISHDE
BLAST against CATH

[top]
Domain History Events (24)

Domain assigned by auto on 11 Dec 2008 04:22

Assigning to "3.90.230.10" based on similarity with "2gg5A00"

Flow stage update by auto on 11 Dec 2008 04:08

No in_process hits for Domain "2gg2A00" ready to be processed

Update comment by auto on 11 Dec 2008 02:46

Domain "2gg2A00" hits Domain "2gg7A00" (100% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 01:31

Domain "2gg2A00" hits Domain "2gg9A00" (100% over 100%) which is currently in process

Update comment by auto on 11 Dec 2008 00:20

Domain "2gg2A00" hits Domain "2gg5A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 23:44

Domain "2gg2A00" hits Domain "2gg3A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 23:20

Domain "2gg2A00" hits Domain "2g6pA00" (46.3878326996198% over 84.8684210526316%) which is currently in process

Update comment by auto on 10 Dec 2008 23:04

Domain "2gg2A00" hits Domain "2evoB00" (100% over 99.6212121212121%) which is currently in process

Update comment by auto on 10 Dec 2008 22:50

Domain "2gg2A00" hits Domain "2evoA00" (100% over 99.6212121212121%) which is currently in process

Update comment by auto on 10 Dec 2008 22:36

Domain "2gg2A00" hits Domain "2evmA00" (100% over 99.6212121212121%) which is currently in process

Update comment by auto on 10 Dec 2008 22:17

Domain "2gg2A00" hits Domain "2evcA00" (100% over 99.6212121212121%) which is currently in process

Update comment by auto on 10 Dec 2008 22:04

Domain "2gg2A00" hits Domain "2b3kA00" (46.3878326996198% over 84.8684210526316%) which is currently in process

Update comment by auto on 10 Dec 2008 21:52

Domain "2gg2A00" hits Domain "2b3hA00" (46.3878326996198% over 84.8684210526316%) which is currently in process

Update comment by auto on 10 Dec 2008 21:47

Domain "2gg2A00" hits Domain "2b3lA00" (46.3878326996198% over 84.5901639344262%) which is currently in process

Update comment by auto on 10 Dec 2008 21:33

Domain "2gg2A00" hits Domain "2q94A00" (100% over 99.6197718631179%) which is currently in process

Update comment by auto on 10 Dec 2008 21:14

Domain "2gg2A00" hits Domain "2q93A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 20:47

Domain "2gg2A00" hits Domain "2q96A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 20:29

Domain "2gg2A00" hits Domain "2q95A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 14:32

Domain "2gg2A00" hits Domain "2q92A00" (100% over 99.6197718631179%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:18

Domain "2gg2A00" hits Domain "2q92A00" (100% over 99.6197718631179%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2gg2A00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2gg2A00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2gg2A00"

Insertion by auto on 05 Dec 2008 18:32

Final ChopClose added based on similarity with "2gg8A"