CATH Domain: 2gasA02 XML data for domain: 2gasA02

Molscript image for 2gasA02
2gasA02
PDB coordinates for domain 2gasA02

PDB 2gas, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.25 UDP-galactose 4-epimerase; domain 1
3.90.25.10 UDP-galactose 4-epimerase, domain 1 Gene3D
3.90.25.10.3
3.90.25.10.3.1
3.90.25.10.3.1.1
3.90.25.10.3.1.1.1
3.90.25.10.3.1.1.1.1

[top]
Segment boundaries for domain 2gasA02

Chopping figure for domain 2gasA02
DomainStart PDB ResidueStop PDB Residue
2gasA01 3 162
2gasA01 202 224
2gasA01 289 302
2gasA02 163 201
2gasA02 225 288
2gasA02 303 318

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.25.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3i6iA02 89.04 Putative leucoanthocyanidin reductase 1Vitis vinifera 3.90.25.10 114 31 93 1.71 1.83
2r6jA02 88.80 Eugenol synthase 1Ocimum basilicum 3.90.25.10 128 36 90 2.11 2.33
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2gasA02
CHAFTGYFLRNLAQLDATDPPRDKVVILGDGNVKGAYVTIRLPKNYLTQNEVIALWEKKIGKTLEKTYVSEEQVLKDIQE
SSFPHNYLLALYHSQQIKGDAVYPDVTYTTADEYLNQFV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2gasA02
CHAFTGYFLRNLAQLDATDPPRDKVVILGDGNVKGAYVTIRLPKNYLTQNEVIALWEKKIGKTLEKTYVSEEQVLKDIQE
SSFPHNYLLALYHSQQIKGDAVYPDVTYTTADEYLNQFV
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 20 Oct 2008 15:36

Assigning to "3.90.25.10" based on similarity with "1qycA02"

Flow stage update by auto on 20 Oct 2008 15:35

No in_process hits for Domain "2gasA02" ready to be processed

Update comment by auto on 20 Oct 2008 15:33

Domain "2gasA02" hits Domain "1qydA02" (43.6974789915966% over 98.3471074380165%) which is currently in process

Update comment by auto on 20 Oct 2008 15:31

Domain "2gasA02" hits Domain "1qydD02" (43.6974789915966% over 98.3471074380165%) which is currently in process

Update comment by auto on 20 Oct 2008 15:29

Domain "2gasA02" hits Domain "1qydC02" (43.6974789915966% over 98.3471074380165%) which is currently in process

Update comment by auto on 20 Oct 2008 15:27

Domain "2gasA02" hits Domain "1qydB02" (43.6974789915966% over 98.3471074380165%) which is currently in process

Update comment by auto on 23 Jul 2008 18:26

Domain "2gasA02" hits Domain "1qycA02" (60.5042016806723% over 99.1666666666667%) which is currently in process

Update comment by auto on 03 Sep 2007 20:18

Domain "2gasA02" hits Domain "1qycA02" (60.5042016806723% over 99.1666666666667%) which is currently in process

Update comment by auto on 03 Sep 2007 11:24

Domain "2gasA02" hits Domain "1qycA02" (60.5042016806723% over 99.1666666666667%) which is currently in process

Update comment by auto on 26 Aug 2007 18:21

Domain "2gasA02" hits Domain "1qycA02" (60.5042016806723% over 99.1666666666667%) which is currently in process

Flow stage update by auto on 26 Aug 2007 18:09

Domain "2gasA02" hits Domain "1qycA02" (60.5042016806723% over 99.1666666666667%) which is currently in process

Flow stage update by auto on 26 Aug 2007 18:09

NW result present for Domain "2gasA02"

Flow stage update by auto on 22 Aug 2007 10:08

All required files are present for Domain "2gasA02"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "2gasA02"

Insertion by auto on 21 Aug 2007 14:38

Final ChopClose added based on similarity with "2gasB"