CATH Domain: 2gasA01 XML data for domain: 2gasA01

Molscript image for 2gasA01
2gasA01
PDB coordinates for domain 2gasA01

PDB 2gas, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.720 NAD(P)-binding Rossmann-like Domain Gene3D
3.40.50.720.14
3.40.50.720.14.1
3.40.50.720.14.1.1
3.40.50.720.14.1.1.1
3.40.50.720.14.1.1.1.1

Segment boundaries for domain 2gasA01

Chopping figure for domain 2gasA01
DomainStart PDB ResidueStop PDB Residue
2gasA01 3 162
2gasA01 202 224
2gasA01 289 302
2gasA02 163 201
2gasA02 225 288
2gasA02 303 318

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.40.50.720.14.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2axqA01 81.37 Lysine biosynthetic process via aminoadipic acidIdentical protein bindingSaccharopine dehydrogenase (NADP+, L-glutamate forming) [EC:1.5.1.10]Saccharopine dehydrogenase [NADP+, L-glutamate-forming]Metabolic pathways 3.40.50.720 174 13 80 2.73 3.40
1ek6A02 79.91 Amino sugar and nucleotide sugar metabolismGalactose metabolismUDP-glucose 4-epimeraseProtein homodimerization activityUDP-glucose 4-epimerase activity 3.40.50.720 218 19 76 3.46 4.52
2a4kB01 79.53 3.40.50.720 196 12 77 3.80 4.90
1n7hA02 79.36 Amino sugar and nucleotide sugar metabolismGDPmannose 4,6-dehydratase [EC:4.2.1.47]Fructose and mannose metabolismCytosolMetabolic pathways 3.40.50.720 231 12 76 3.72 4.85
2bllA01 79.23 Amino sugar and nucleotide sugar metabolismOxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorHydroxymethyl-, formyl- and related transferase activityUDP-GlcUA decarboxylase/UDP-L-Ara4N formyltransferase [EC:1.1.1.- 2.1.2.-]Bifunctional polymyxin resistance protein ArnA 3.40.50.720 243 18 69 2.85 4.12
1dihA01 78.97 Metabolic pathwaysLysine biosynthesisDihydrodipicolinate reductase [EC:1.3.1.26]Dihydrodipicolinate reductaseEscherichia coli K-12 3.40.50.720 164 11 76 3.44 4.49
1e6uA01 78.66 Amino sugar and nucleotide sugar metabolismFructose and mannose metabolismMetabolic pathwaysGDP-L-fucose synthaseGDP-L-fucose synthase [EC:1.1.1.271] 3.40.50.720 220 12 72 3.52 4.84
1wvgA01 78.20 3.40.50.720 193 12 77 3.76 4.87
1f06A01 77.18 Lysine biosynthesisDiaminopimelate dehydrogenase [EC:1.4.1.16]Corynebacterium glutamicumMeso-diaminopimelate D-dehydrogenase 3.40.50.720 168 11 72 3.52 4.83
1eq2A01 77.12 Metabolic pathwaysLipopolysaccharide biosynthesisMembraneProtein bindingADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20] 3.40.50.720 202 9 83 3.37 4.05
2hrzA01 76.46 Agrobacterium tumefaciens str. C58Nucleoside-diphosphate-sugar epimerase 3.40.50.720 224 12 73 3.64 4.97
1yl5A01 75.85 Metabolic pathwaysLysine biosynthesisDihydrodipicolinate reductase [EC:1.3.1.26]Dihydrodipicolinate reductaseMycobacterium tuberculosis 3.40.50.720 140 11 66 2.90 4.36
Displaying entries 1 to 12 (page 1 of 1)


Domain ATOM Sequence

>pdb|2gasA01
TENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIV
ICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVIEAEGVPYTYLCEADVGTFTI
RAANDPNTLNKAVHEIDPAKDIEASEAY    

Domain COMBS Sequence

>pdb|2gasA01
TENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIV
ICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVIEAEGVPYTYLCEADVGTFTI
RAANDPNTLNKAVHEIDPAKDIEASEAY    

Domain History Events (11)

Domain assigned by auto on 20 Oct 2008 15:30

Assigning to "3.40.50.720" based on similarity with "1qycA01"

Flow stage update by auto on 20 Oct 2008 15:29

No in_process hits for Domain "2gasA01" ready to be processed

Update comment by auto on 23 Jul 2008 18:26

Domain "2gasA01" hits Domain "1qycA01" (54.2553191489362% over 98.936170212766%) which is currently in process

Update comment by auto on 03 Sep 2007 20:18

Domain "2gasA01" hits Domain "1qycA01" (54.2553191489362% over 98.936170212766%) which is currently in process

Update comment by auto on 03 Sep 2007 11:24

Domain "2gasA01" hits Domain "1qycA01" (54.2553191489362% over 98.936170212766%) which is currently in process

Update comment by auto on 26 Aug 2007 18:21

Domain "2gasA01" hits Domain "1qycA01" (54.2553191489362% over 98.936170212766%) which is currently in process

Flow stage update by auto on 26 Aug 2007 18:09

Domain "2gasA01" hits Domain "1qycA01" (54.2553191489362% over 98.936170212766%) which is currently in process

Flow stage update by auto on 26 Aug 2007 18:09

NW result present for Domain "2gasA01"

Flow stage update by auto on 22 Aug 2007 10:08

All required files are present for Domain "2gasA01"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "2gasA01"

Insertion by auto on 21 Aug 2007 14:38

Final ChopClose added based on similarity with "2gasB"