CATH Domain: 2g82A02 XML data for domain: 2g82A02

Molscript image for 2g82A02
2g82A02
PDB coordinates for domain 2g82A02

PDB 2g82, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.3
3.30.360.10.3.2
3.30.360.10.3.2.1
3.30.360.10.3.2.1.1
3.30.360.10.3.2.1.1.1

[top]
Segment boundaries for domain 2g82A02

Chopping figure for domain 2g82A02
DomainStart PDB ResidueStop PDB Residue
2g82A01 1 147
2g82A01 312 330
2g82A02 148 311

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.360.10.3.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2yyyA02 84.73 Methanocaldococcus jannaschiiGlycolysis / GluconeogenesisGlyceraldehyde-3-phosphate dehydrogenaseGlyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]Metabolic pathways 3.30.360.10 168 16 85 2.97 3.49
2hjsA02 80.50 Pseudomonas aeruginosaCysteine and methionine metabolismAspartate-semialdehyde dehydrogenase [EC:1.2.1.11]Glycine, serine and threonine metabolismUSG-1 protein homolog 3.30.360.10 184 13 78 2.60 3.32
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2g82A02
STTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLRRARAAAINIIPTTTGAAKATALVLPSLKGRFDGMA
LRVPTATGSISDITALLKREVTAEEVNAALKAAAEGPLKGILAYTEDEIVLQDIVMDPHSSIVDAKLTKALGNMVKVFAW
YDN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2g82A02
SXTTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLRRARAAAINIIPTTTGAAKATALVLPSLKGRFDGM
ALRVPTATGSISDITALLKREVTAEEVNAALKAAAEGPLKGILAYTEDEIVLQDIVMDPHSSIVDAKLTKALGNMVKVFA
WYDN
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 26 Jul 2007 07:07

Assigning to "3.30.360.10" based on similarity with "1cerO02"

Flow stage update by auto on 26 Jul 2007 07:02

No in_process hits for Domain "2g82A02" ready to be processed

Flow stage update by auto on 26 Jul 2007 07:02

NW result present for Domain "2g82A02"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2g82A02"

Flow stage update by auto on 14 Jul 2007 12:51

Beginning processing for Domain "2g82A02"

Insertion by auto on 14 Jul 2007 10:29

Final ChopClose added based on similarity with "1cerO"