CATH Domain: 2g30A02 XML data for domain: 2g30A02

Molscript image for 2g30A02
2g30A02
PDB coordinates for domain 2g30A02

PDB 2g30, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.310 TATA-Binding Protein
3.30.310.10 TATA-Binding Protein Gene3D
3.30.310.10.4
3.30.310.10.4.1
3.30.310.10.4.1.1
3.30.310.10.4.1.1.1
3.30.310.10.4.1.1.1.1

[top]
Segment boundaries for domain 2g30A02

Chopping figure for domain 2g30A02
DomainStart PDB ResidueStop PDB Residue
2g30A01 705 821
2g30A02 822 937

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.310.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r4xA02 83.97 Coatomer subunit gammaHomo sapiensProtein binding 3.30.310.30 114 10 92 3.14 3.40
1kyfA02 83.86 Mus musculusStored secretory granuleAP-2 complex subunit alpha-2Intracellular protein transport 3.30.310.30 113 16 93 2.69 2.89
3c6kA01 77.99 Spermine synthaseArginine and proline metabolismSpermine synthase [EC:2.5.1.22]Glutathione metabolismMetabolic pathways 3.30.160.110 94 14 68 3.36 4.87
1v8cA02 77.31 Threonine synthaseThermus thermophilus 3.30.1370.80 80 5 62 2.61 4.15
1harA02 75.45 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 7 54 2.71 4.99
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2g30A02
LNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILA
ELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2g30A02
LNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILA
ELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 22:07

Assigning to "3.30.310.10" based on similarity with "1e42A02" (NWSI: 100, NWO: 100, SPS: 97.63, SPO: 100, RMSD: 0.43)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2g30A02"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2g30A02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2g30A02"

Insertion by auto on 19 Mar 2006 09:24

Final ChopClose added based on similarity with "1e42A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.52, SI: 100, SO: 100]