CATH Domain: 2fziA00 XML data for domain: 2fziA00

Molscript image for 2fziA00
2fziA00
PDB coordinates for domain 2fziA00

PDB 2fzi, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.9
3.40.430.10.9.1
3.40.430.10.9.1.1
3.40.430.10.9.1.1.1
3.40.430.10.9.1.1.1.1

[top]
Segment boundaries for domain 2fziA00

Chopping figure for domain 2fziA00
DomainStart PDB ResidueStop PDB Residue
2fziA00 1 206

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.430.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2bl9A00 86.96 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 28 83 2.36 2.82
1qzfA01 86.52 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 30 83 2.08 2.48
1cz3B00 83.17 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 21 79 3.44 4.32
1vdrA00 82.34 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 24 75 2.00 2.64
2hxvA02 78.48 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 13 77 3.25 4.18
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fziA00
MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVI
TRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKF
RDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fziA00
MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRKTWESIPLQFRPLKGRINVVI
TRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKF
RDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFEMWTRDL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 11 Jan 2007 19:44

Assigning to "3.40.430.10" based on similarity with "4cd2A00"

Flow stage update by auto on 11 Jan 2007 19:36

No in_process hits for Domain "2fziA00" ready to be processed

Update comment by auto on 11 Jan 2007 15:48

Domain "2fziA00" hits Domain "2fzjA00" (35.4838709677419% over 89.8058252427184%) which is currently in process

Flow stage update by auto on 11 Jan 2007 15:42

Domain "2fziA00" hits Domain "2fzjA00" (35.4838709677419% over 89.8058252427184%) which is currently in process

Flow stage update by auto on 11 Jan 2007 15:42

NW result present for Domain "2fziA00"

Flow stage update by auto on 09 Jan 2007 15:38

All required files are present for Domain "2fziA00"

Flow stage update by auto on 08 Jan 2007 23:41

Beginning processing for Domain "2fziA00"

Insertion by auto on 08 Jan 2007 23:26

Final ChopClose added based on similarity with "1cd2A"