Domain assigned by cuff on 10 Mar 2008 21:49
not enough evidence for homology to pre existing superfamily
CATH Domain: 2fyxA00
2fyxA00
PDB 2fyx, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2fyxA00 MKKGRGYVYKLEYHLIWATKYRHQVLVDEVADGLKDILRDIATQNGLELVALEVMPDYVHLLLGATPQHVIPDFVKALKG ASARRMFSAFPHLKQPHWGGNLWNPSYCVLTVSEHTRAQIQQYIENQHAA
Domain History Events (209)
Domain assignment manual match t by cuff on 10 Mar 2008 21:39
same fold but no evidence for homology match
Homcheck comment by cuff on 07 Feb 2008 16:47
coming back -not entirely convinced of homology
Domain assignment manual match h by rupa on 11 Sep 2007 11:11
Previous mistake was to note that the fold is the same but I should have classed this to the fold level. I think the score may be high enough for homology, but not 100% sure.
Domain assignment manual match a by rupa on 20 Aug 2007 16:10
Good cathedral and ssap scores. Same folding. Unknown function, different pfam classes.
Homcheck review by rupa on 20 Aug 2007 16:10
Good cathedral and ssap scores. Same folding. Unknown function, different pfam classes.
Flow stage update by rupa on 20 Aug 2007 16:10
Good cathedral and ssap scores. Same folding. Unknown function, different pfam classes.
Homcheck allotment by rupa on 20 Aug 2007 16:06
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 20 Aug 2007 16:06
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 20 Aug 2007 11:45
Domain "2fyxA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 20 Aug 2007 11:45
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2fyxA00
Flow stage update by auto on 20 Aug 2007 04:00
Retrieved PRC_PFAMCATH results for job ID SID9052902139733592 and chopping inserted.
Domain scan prc pfamcath by auto on 20 Aug 2007 03:59
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2fyxA00
Update comment by auto on 19 Aug 2007 19:33
PRC_PFAMCATH job SID9052902139733592 is not yet finished.
Prc pfamcath submit by auto on 19 Aug 2007 19:30
The entry "2fyxA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 19 Aug 2007 19:30
The entry "2fyxA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 19 Aug 2007 15:22
Giving up on PRC_PFAMCATH job SID9529897623815588 because submission time of Fri Aug 17 13:16:36 2007 is more than 172800 seconds older than current time (Sun Aug 19 15:22:12 2007).
Update comment by auto on 17 Aug 2007 13:19
PRC_PFAMCATH job SID9529897623815588 is not yet finished.
Prc pfamcath submit by auto on 17 Aug 2007 13:16
The entry "2fyxA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 17 Aug 2007 13:16
The entry "2fyxA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 17 Aug 2007 11:48
Retrieved SSAP results for job ID SID3086031174727904 and chopping inserted.
Domain scan ssap cath by auto on 17 Aug 2007 11:44
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3179 results for 2fyxA00
Update comment by auto on 16 Aug 2007 23:34
SSAP job SID3086031174727904 is not yet finished.
Flow stage update by auto on 16 Aug 2007 22:30
The entry "2fyxA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 16 Aug 2007 22:30
The entry "2fyxA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 16 Aug 2007 17:26
Giving up on SSAP job SID4376421949041280 because submission time of Tue Aug 14 08:24:22 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:26:04 2007).
Update comment by auto on 14 Aug 2007 09:58
SSAP job SID4376421949041280 is not yet finished.
Ssap cath submit by auto on 14 Aug 2007 08:24
The entry "2fyxA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 14 Aug 2007 08:24
The entry "2fyxA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 14 Aug 2007 02:19
Retrieved PRC results for job ID SID1797003680696832 and inserted them into the database.
Domain scan prc cath by auto on 14 Aug 2007 02:18
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2fyxA00
Flow stage update by auto on 13 Aug 2007 09:30
The entry "2fyxA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 13 Aug 2007 09:30
The entry "2fyxA00" has been submitted to the PRC webservice.
Flow stage update by auto on 13 Aug 2007 04:10
Retrieved HMM(SAM) results for job ID SID7581516245599584 and inserted them into the database.
Domain scan sam cath by auto on 13 Aug 2007 04:09
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2fyxA00
Update comment by auto on 12 Aug 2007 12:38
HMM(SAM) job SID7581516245599584 is not yet finished.
Flow stage update by auto on 12 Aug 2007 06:28
The entry "2fyxA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 12 Aug 2007 06:28
The entry "2fyxA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 11 Aug 2007 21:34
Retrieved "2fyxA00" CATHEDRAL results for job ID SID8178046694625728 and inserted them into the database.
Domain scan cathedral cath by auto on 11 Aug 2007 21:33
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 198 results for 2fyxA00
Update comment by auto on 11 Aug 2007 05:19
"2fyxA00" CATHEDRAL job SID8178046694625728 is not yet finished.
Cathedral cath submit by auto on 11 Aug 2007 03:38
The entry "2fyxA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 11 Aug 2007 03:38
The entry "2fyxA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 11 Aug 2007 00:57
ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2fyxA00.scanlist" for "2fyxA00"
Write scan list by auto on 11 Aug 2007 00:57
Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2fyxA00.scanlist" for domain "2fyxA00"
Update comment by auto on 10 Aug 2007 14:29
Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 10:28
Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 06:41
Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Aug 2007 02:42
Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 22:29
Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 19:09
Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 14:52
Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 10:52
Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 06:39
Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 09 Aug 2007 02:45
Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 22:29
Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 18:36
Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 14:35
Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 10:59
Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 06:44
Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 08 Aug 2007 02:50
Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 22:39
Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 19:25
Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 15:06
Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 10:36
Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 06:47
Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 07 Aug 2007 02:42
Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 22:30
Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 18:44
Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 14:38
Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 11:15
Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 09:09
Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 06 Aug 2007 02:05
Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 18:57
Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 07:11
Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 05 Aug 2007 03:03
Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 22:44
Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 18:58
Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 14:59
Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 10:59
Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 06:51
Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 04 Aug 2007 02:59
Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 22:48
Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 19:44
Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 15:38
Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 10:50
Waiting for 3055 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 06:52
Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Aug 2007 02:51
Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 22:39
Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 19:19
Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 15:11
Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 10:52
Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 06:52
Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Aug 2007 02:52
Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 22:36
Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 19:23
Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 14:53
Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 10:44
Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 06:45
Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Aug 2007 02:50
Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 22:33
Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 18:51
Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 14:43
Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 11:01
Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 07:14
Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Jul 2007 03:19
Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jul 2007 23:22
Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jul 2007 19:44
Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jul 2007 16:15
Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jul 2007 09:54
Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jul 2007 02:20
Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jul 2007 11:19
Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jul 2007 07:19
Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jul 2007 03:19
Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jul 2007 00:24
Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Jul 2007 19:00
Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Jul 2007 14:55
Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Jul 2007 10:56
Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Jul 2007 06:59
Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Jul 2007 03:04
Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 22:40
Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 18:58
Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 14:51
Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 10:46
Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 06:45
Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Jul 2007 02:41
Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 23:05
Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 19:22
Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 15:47
Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 11:19
Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 07:23
Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 04:36
Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jul 2007 00:49
Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Jul 2007 15:21
Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Jul 2007 11:05
Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Jul 2007 07:04
Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Jul 2007 02:58
Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 22:47
Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 19:12
Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 15:09
Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 11:05
Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 07:09
Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Jul 2007 03:03
Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 23:03
Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 19:16
Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 15:07
Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 11:15
Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 07:21
Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 23 Jul 2007 03:34
Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Jul 2007 19:36
Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Jul 2007 15:32
Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Jul 2007 11:29
Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Jul 2007 07:23
Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Jul 2007 03:45
Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 23:26
Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 19:23
Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 15:28
Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 11:30
Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 07:24
Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Jul 2007 03:46
Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 23:23
Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 19:55
Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 16:45
Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 11:17
Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 07:07
Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 20 Jul 2007 03:03
Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 23:14
Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 19:40
Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 15:42
Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 11:28
Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 07:13
Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 19 Jul 2007 03:28
Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 22:56
Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 19:11
Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 15:07
Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 11:25
Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 07:21
Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.
Update comment by auto on 18 Jul 2007 02:47
Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.
Update comment by auto on 17 Jul 2007 22:01
Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Jul 2007 15:59
Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Jul 2007 11:04
Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Jul 2007 07:12
Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Jul 2007 03:13
Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 22:59
Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 19:19
Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 15:37
Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 10:58
Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 06:40
Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 04:45
Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Jul 2007 01:19
Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 22:54
Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 19:40
Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 15:32
Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 11:57
Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 07:25
Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Jul 2007 03:29
Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Jul 2007 23:17
Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Jul 2007 21:18
Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Jul 2007 18:09
Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Jul 2007 13:02
Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Jul 2007 06:10
Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Jul 2007 19:01
Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Jul 2007 16:13
Waiting for 1013 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 12 Jul 2007 16:09
No satisfactory AssignClose result found.
Flow stage update by auto on 12 Jul 2007 16:07
No in_process hits for Domain "2fyxA00" ready to be processed
Flow stage update by auto on 12 Jul 2007 16:07
NW result present for Domain "2fyxA00"
Flow stage update by auto on 07 Jul 2007 20:00
All required files are present for Domain "2fyxA00"
Flow stage update by auto on 06 Jul 2007 14:25
Beginning processing for Domain "2fyxA00"
Insertion by cuff on 06 Jul 2007 13:07
nice chopping
