CATH Domain: 2fxuA02 XML data for domain: 2fxuA02

Molscript image for 2fxuA02
2fxuA02
PDB coordinates for domain 2fxuA02

PDB 2fxu, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.8
3.30.420.40.8.1
3.30.420.40.8.1.1
3.30.420.40.8.1.1.1
3.30.420.40.8.1.1.1.1

[top]
Segment boundaries for domain 2fxuA02

Chopping figure for domain 2fxuA02
DomainStart PDB ResidueStop PDB Residue
2fxuA01 4 137
2fxuA01 339 371
2fxuA02 138 179
2fxuA02 272 338
2fxuA03 180 271

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.420.40.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1k8kA03 89.98 Bos taurusActin-related protein 3 3.30.420.40 129 38 79 1.35 1.69
1jcfA02 85.99 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 22 79 2.01 2.52
1e4fT04 82.36 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 13 78 2.54 3.22
3h1qA02 79.49 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 13 64 2.08 3.22
1woqA01 78.45 Inorganic polyphosphate/ATP-glucomannokinaseArthrobacter sp. KM 3.30.420.40 112 5 74 3.28 4.43
1ig8A02 77.63 Galactose metabolismRegulation of cell sizeMannose metabolic processGlucose importMetabolic pathways 3.30.420.40 134 9 67 3.30 4.91
2gupA01 77.40 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 7 67 3.21 4.73
1huxA02 76.30 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 140 10 49 1.80 3.65
2hoeA03 75.58 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 143 8 61 2.50 4.06
2gelA02 75.32 Putative molecular chaperoneSalmonella enterica subsp. enterica serovar Typhimurium 3.30.420.40 95 9 71 3.09 4.32
3bzcA03 74.85 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 11 67 3.16 4.65
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fxuA02
AVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGI
ADRMQKEITALAPSTMKIKIIAPPERKYS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fxuA02
AVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGI
ADRMQKEITALAPSTMKIKIIAPPERKYS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 22:06

Assigning to "3.30.420.40" based on similarity with "1y64A02" (NWSI: 100, NWO: 100, SPS: 93.85, SPO: 100, RMSD: 0.75)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2fxuA02"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2fxuA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2fxuA02"

Insertion by auto on 17 Mar 2006 21:53

Final ChopClose added based on similarity with "1wuaA" [LEE: 1, LME: 0, MR: 0, LG: 2, SS: 96.21, SI: 99.7333333333333, SO: 100]